Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  TIE2 KINASE DOMAIN
 
Authors :  L. M. Shewchuk, A. M. Hassell, B. Ellis, W. D. Holmes, R. Davis, E. L. Horne, S. H. Kadwell, D. D. Mckee, J. T. Moore
Date :  20 Sep 00  (Deposition) - 20 Sep 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Tyrosine Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. M. Shewchuk, A. M. Hassell, B. Ellis, W. D. Holmes, R. Davis, E. L. Horne, S. H. Kadwell, D. D. Mckee, J. T. Moore
Structure Of The Tie2 Rtk Domain: Self-Inhibition By The Nucleotide Binding Loop, Activation Loop, And C-Terminal Tail.
Structure Fold. Des. V. 8 1105 2000
PubMed-ID: 11080633  |  Reference-DOI: 10.1016/S0969-2126(00)00516-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TYROSINE-PROTEIN KINASE TIE-2
    ChainsA, B
    EC Number2.7.1.112
    EngineeredYES
    Expression SystemUNIDENTIFIED BACULOVIRUS
    Expression System Taxid10469
    FragmentKINASE DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FVR)

(-) Sites  (0, 0)

(no "Site" information available for 1FVR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FVR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Tyr A:816 -Pro A:817
2Tyr B:816 -Pro B:817

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (15, 30)

Asymmetric Unit (15, 30)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_006352R849WTIE2_HUMANDisease (VMCM)80338908A/BR849W
02UniProtVAR_041861P883ATIE2_HUMANUnclassified  ---A/BP883A
03UniProtVAR_066606Y897CTIE2_HUMANDisease (VMCM)80338909A/BY897C
04UniProtVAR_078049Y897FTIE2_HUMANUnclassified  ---A/BY897F
05UniProtVAR_078050Y897HTIE2_HUMANUnclassified  ---A/BY897H
06UniProtVAR_008716Y897STIE2_HUMANDisease (VMCM)80338909A/BY897S
07UniProtVAR_078051L914FTIE2_HUMANUnclassified  ---A/BL914F
08UniProtVAR_078052R915CTIE2_HUMANUnclassified  ---A/BR915C
09UniProtVAR_066607R915HTIE2_HUMANDisease (VMCM)387906745A/BR915H
10UniProtVAR_078053R915LTIE2_HUMANUnclassified  ---A/BR915L
11UniProtVAR_078054S917ITIE2_HUMANUnclassified  ---A/BS917I
12UniProtVAR_066608R918CTIE2_HUMANDisease (VMCM)  ---A/BR918C
13UniProtVAR_066609V919LTIE2_HUMANDisease (VMCM)  ---A/BV919L
14UniProtVAR_066610A925STIE2_HUMANDisease (VMCM)  ---A/BA925S
15UniProtVAR_066611K1100NTIE2_HUMANDisease (VMCM)  ---A/BK1100N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_006352R849WTIE2_HUMANDisease (VMCM)80338908AR849W
02UniProtVAR_041861P883ATIE2_HUMANUnclassified  ---AP883A
03UniProtVAR_066606Y897CTIE2_HUMANDisease (VMCM)80338909AY897C
04UniProtVAR_078049Y897FTIE2_HUMANUnclassified  ---AY897F
05UniProtVAR_078050Y897HTIE2_HUMANUnclassified  ---AY897H
06UniProtVAR_008716Y897STIE2_HUMANDisease (VMCM)80338909AY897S
07UniProtVAR_078051L914FTIE2_HUMANUnclassified  ---AL914F
08UniProtVAR_078052R915CTIE2_HUMANUnclassified  ---AR915C
09UniProtVAR_066607R915HTIE2_HUMANDisease (VMCM)387906745AR915H
10UniProtVAR_078053R915LTIE2_HUMANUnclassified  ---AR915L
11UniProtVAR_078054S917ITIE2_HUMANUnclassified  ---AS917I
12UniProtVAR_066608R918CTIE2_HUMANDisease (VMCM)  ---AR918C
13UniProtVAR_066609V919LTIE2_HUMANDisease (VMCM)  ---AV919L
14UniProtVAR_066610A925STIE2_HUMANDisease (VMCM)  ---AA925S
15UniProtVAR_066611K1100NTIE2_HUMANDisease (VMCM)  ---AK1100N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_006352R849WTIE2_HUMANDisease (VMCM)80338908BR849W
02UniProtVAR_041861P883ATIE2_HUMANUnclassified  ---BP883A
03UniProtVAR_066606Y897CTIE2_HUMANDisease (VMCM)80338909BY897C
04UniProtVAR_078049Y897FTIE2_HUMANUnclassified  ---BY897F
05UniProtVAR_078050Y897HTIE2_HUMANUnclassified  ---BY897H
06UniProtVAR_008716Y897STIE2_HUMANDisease (VMCM)80338909BY897S
07UniProtVAR_078051L914FTIE2_HUMANUnclassified  ---BL914F
08UniProtVAR_078052R915CTIE2_HUMANUnclassified  ---BR915C
09UniProtVAR_066607R915HTIE2_HUMANDisease (VMCM)387906745BR915H
10UniProtVAR_078053R915LTIE2_HUMANUnclassified  ---BR915L
11UniProtVAR_078054S917ITIE2_HUMANUnclassified  ---BS917I
12UniProtVAR_066608R918CTIE2_HUMANDisease (VMCM)  ---BR918C
13UniProtVAR_066609V919LTIE2_HUMANDisease (VMCM)  ---BV919L
14UniProtVAR_066610A925STIE2_HUMANDisease (VMCM)  ---BA925S
15UniProtVAR_066611K1100NTIE2_HUMANDisease (VMCM)  ---BK1100N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.TIE2_HUMAN830-855
 
  2A:830-855
B:830-855
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.TIE2_HUMAN960-972
 
  2A:960-972
B:960-972
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.TIE2_HUMAN830-855
 
  1A:830-855
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.TIE2_HUMAN960-972
 
  1A:960-972
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.TIE2_HUMAN830-855
 
  1-
B:830-855
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.TIE2_HUMAN960-972
 
  1-
B:960-972

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003800361bENSE00001483540chr9:27109147-27109640494TIE2_HUMAN1-18180--
1.2ENST000003800362ENSE00001374032chr9:27157829-27158140312TIE2_HUMAN18-1221050--
1.3ENST000003800363ENSE00000813529chr9:27168493-27168603111TIE2_HUMAN122-159380--
1.4aENST000003800364aENSE00000813530chr9:27169475-27169627153TIE2_HUMAN159-210520--
1.5ENST000003800365ENSE00000813531chr9:27172614-27172745132TIE2_HUMAN210-254450--
1.6ENST000003800366ENSE00000813532chr9:27173220-27173360141TIE2_HUMAN254-301480--
1.7aENST000003800367aENSE00000813533chr9:27180238-27180366129TIE2_HUMAN301-344440--
1.8ENST000003800368ENSE00001749181chr9:27183457-27183608152TIE2_HUMAN344-394510--
1.9ENST000003800369ENSE00001621905chr9:27185483-27185627145TIE2_HUMAN395-443490--
1.10ENST0000038003610ENSE00001614493chr9:27190527-27190688162TIE2_HUMAN443-497550--
1.11ENST0000038003611ENSE00001750035chr9:27192487-27192621135TIE2_HUMAN497-542460--
1.12ENST0000038003612ENSE00001637869chr9:27197313-27197597285TIE2_HUMAN542-637960--
1.13bENST0000038003613bENSE00001711672chr9:27202818-27203117300TIE2_HUMAN637-7371010--
1.14bENST0000038003614bENSE00001748389chr9:27204909-27205063155TIE2_HUMAN737-788520--
1.15ENST0000038003615ENSE00001695490chr9:27206580-27206790211TIE2_HUMAN789-859712A:813-859
B:813-859
47
47
1.16ENST0000038003616ENSE00001621003chr9:27209119-27209229111TIE2_HUMAN859-896382A:859-896 (gaps)
B:859-896 (gaps)
38
38
1.17ENST0000038003617ENSE00001797382chr9:27212705-27212895191TIE2_HUMAN896-959642A:896-959
B:896-959
64
64
1.18ENST0000038003618ENSE00001617075chr9:27213482-27213595114TIE2_HUMAN960-997382A:960-995
B:960-995
36
36
1.19ENST0000038003619ENSE00001635180chr9:27217686-2721775671TIE2_HUMAN998-1021242A:1000-1021
B:999-1021
22
23
1.20ENST0000038003620ENSE00001599995chr9:27218775-2721881541TIE2_HUMAN1021-1035152A:1021-1035
B:1021-1035
15
15
1.21ENST0000038003621ENSE00001720679chr9:27220047-2722014397TIE2_HUMAN1035-1067332A:1035-1067
B:1035-1067
33
33
1.22ENST0000038003622ENSE00001712731chr9:27228204-27228303100TIE2_HUMAN1067-1100342A:1067-1100
B:1067-1100
34
34
1.23eENST0000038003623eENSE00001838203chr9:27229156-272301731018TIE2_HUMAN1101-1124242A:1101-1121
B:1101-1121
21
21

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:299
 aligned with TIE2_HUMAN | Q02763 from UniProtKB/Swiss-Prot  Length:1124

    Alignment length:309
                                   822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112         
          TIE2_HUMAN    813 PTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE 1121
               SCOP domains d1fvra_ A: Tie2 kinase                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1fvrA01 A:813-904 Phosphorylase Kinase; domain 1                                            1fvrA02 A:905-1112 Transferase(Phosphotransferase) domain 1                                                                                                                                                     --------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhheeeeeee.hhh.eeeeeeeee..eeeeeeeeeee..------hhhhhhhhhhh..........eeeeeee..eeeeee......hhhhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.hhh.eee.....ee...ee...----......hhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh..................hhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------W---------------------------------A-------------C----------------FC-ICL-----S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------F-----------------H-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------------------------------------------------H-----------------L-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE -----------------PROTEIN_KINASE_ATP        --------------------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.15  PDB: A:813-859 UniProt: 789-859     ------------------------------------Exon 1.17  PDB: A:896-959 UniProt: 896-959                      Exon 1.18  PDB: A:960-995 [INCOMPLETE]Exon 1.19 [INCOMPLETE]  -------------Exon 1.21  PDB: A:1035-1067      ---------------------------------Exon 1.23e            Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.16  PDB: A:859-896 (gaps)      ----------------------------------------------------------------------------------------------------------------------------Exon 1.20      -------------------------------Exon 1.22  PDB: A:1067-1100       --------------------- Transcript 1 (2)
                1fvr A  813 PTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEY------RDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKK----LPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE 1121
                                   822       832       842       852       | -    |  872       882       892       902       912       922       932       942       952       962       972       982       992  |   1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112         
                                                                         860    867                                                                                                                             995 1000                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:300
 aligned with TIE2_HUMAN | Q02763 from UniProtKB/Swiss-Prot  Length:1124

    Alignment length:309
                                   822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112         
          TIE2_HUMAN    813 PTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE 1121
               SCOP domains d1fvrb_ B: Tie2 kinase                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1fvrB01 B:813-904 Phosphorylase Kinase; domain 1                                            1fvrB02 B:905-1112 Transferase(Phosphotransferase) domain 1                                                                                                                                                     --------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhheeeeeee.hhh.eeeeeeeee..eeeeeeeeeee..------hhhhhhhhhhhh.........eeeeeee..eeeeee......hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh..ee....hhh.eee.hhh.eee.....ee...ee...---..hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh....................... Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------W---------------------------------A-------------C----------------FC-ICL-----S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------F-----------------H-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------------------------------------------------H-----------------L-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE -----------------PROTEIN_KINASE_ATP        --------------------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.15  PDB: B:813-859 UniProt: 789-859     ------------------------------------Exon 1.17  PDB: B:896-959 UniProt: 896-959                      Exon 1.18  PDB: B:960-995 [INCOMPLETE]Exon 1.19 [INCOMPLETE]  -------------Exon 1.21  PDB: B:1035-1067      ---------------------------------Exon 1.23e            Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.16  PDB: B:859-896 (gaps)      ----------------------------------------------------------------------------------------------------------------------------Exon 1.20      -------------------------------Exon 1.22  PDB: B:1067-1100       --------------------- Transcript 1 (2)
                1fvr B  813 PTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEY------RDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKK---RLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE 1121
                                   822       832       842       852       | -    |  872       882       892       902       912       922       932       942       952       962       972       982       992  |   1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112         
                                                                         860    867                                                                                                                             995 999                                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FVR)

(-) Gene Ontology  (74, 74)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (TIE2_HUMAN | Q02763)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0048014    Tie signaling pathway    The series of molecular signals generated as a consequence of a Tie protein (a receptor) binding to one of its physiological ligands (an angiopoietin).
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0031100    animal organ regeneration    The regrowth of a lost or destroyed animal organ.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0060216    definitive hemopoiesis    A second wave of blood cell production that, in vertebrates, generates long-term hemopoietic stem cells that continously provide erythroid, myeloid and lymphoid lineages throughout adulthood.
    GO:0001958    endochondral ossification    Replacement ossification wherein bone tissue replaces cartilage.
    GO:0001935    endothelial cell proliferation    The multiplication or reproduction of endothelial cells, resulting in the expansion of a cell population. Endothelial cells are thin flattened cells which line the inside surfaces of body cavities, blood vessels, and lymph vessels, making up the endothelium.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0060347    heart trabecula formation    The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0016525    negative regulation of angiogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:0050728    negative regulation of inflammatory response    Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:2000251    positive regulation of actin cytoskeleton reorganization    Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0010595    positive regulation of endothelial cell migration    Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
    GO:0001938    positive regulation of endothelial cell proliferation    Any process that activates or increases the rate or extent of endothelial cell proliferation.
    GO:0051894    positive regulation of focal adhesion assembly    Any process that activates or increases the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
    GO:1902533    positive regulation of intracellular signal transduction    Any process that activates or increases the frequency, rate or extent of intracellular signal transduction.
    GO:0043552    positive regulation of phosphatidylinositol 3-kinase activity    Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0051897    positive regulation of protein kinase B signaling    Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000351    regulation of endothelial cell apoptotic process    Any process that modulates the frequency, rate or extent of endothelial cell apoptotic process.
    GO:0032878    regulation of establishment or maintenance of cell polarity    Any process that modulates the frequency, rate or extent of the specification, formation or maintenance of anisotropic intracellular organization or cell growth patterns.
    GO:0043114    regulation of vascular permeability    Any process that modulates the extent to which blood vessels can be pervaded by fluid.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0043627    response to estrogen    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0010033    response to organic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
    GO:0043434    response to peptide hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0002040    sprouting angiogenesis    The extension of new blood vessels from existing capillaries into avascular tissues resulting from the proliferation of blood vessel endothelial cells.
    GO:0034446    substrate adhesion-dependent cell spreading    The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005884    actin filament    A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0009925    basal plasma membrane    The region of the plasma membrane located at the basal end of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005911    cell-cell junction    A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0005902    microvillus    Thin cylindrical membrane-covered projections on the surface of an animal cell containing a core bundle of actin filaments. Present in especially large numbers on the absorptive surface of intestinal cells.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0001725    stress fiber    A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fvr)
 
  Sites
(no "Sites" information available for 1fvr)
 
  Cis Peptide Bonds
    Tyr A:816 - Pro A:817   [ RasMol ]  
    Tyr B:816 - Pro B:817   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fvr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TIE2_HUMAN | Q02763
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.112
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  600195
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TIE2_HUMAN | Q02763
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TIE2_HUMAN | Q027632gy5 2gy7 2oo8 2osc 2p4i 2wqb 3bea 3l8p 4k0v 4x3j 5mya 5myb 5utk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FVR)