|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1FRE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1FRE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1FRE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1FRE) |
Exons (0, 0)| (no "Exon" information available for 1FRE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:39 aligned with NF7B_XENLA | Q92021 from UniProtKB/Swiss-Prot Length:609 Alignment length:39 231 241 251 NF7B_XENLA 222 EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI 260 SCOP domains d1frea_ A: Nuclear factor XNF7 SCOP domains CATH domains 1freA00 A:4-42 Nuclear Factor Xnf7 CATH domains Pfam domains --------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------- SAPs(SNPs) PROSITE --------------------------------------- PROSITE Transcript --------------------------------------- Transcript 1fre A 4 EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI 42 13 23 33
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1FRE) |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (NF7B_XENLA | Q92021)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|