Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE MINE TOPOLOGICAL SPECIFICITY DOMAIN
 
Authors :  G. F. King, M. W. Maciejewski, B. Pan, G. P. Mullen
Date :  19 Apr 00  (Deposition) - 01 Nov 00  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
Keywords :  Mine, Topological Specificity, Cell Division, Mincd, Minicell, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. F. King, Y. L. Shih, M. W. Maciejewski, N. P. Bains, B. Pan, S. L. Rowland, G. P. Mullen, L. I. Rothfield
Structural Basis For The Topological Specificity Function Of Mine.
Nat. Struct. Biol. V. 7 1013 2000
PubMed-ID: 11062554  |  Reference-DOI: 10.1038/80917
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MINE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentMINE TOPOLOGICAL SPECIFICITY DOMAIN
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymCELL DIVISION TOPOLOGICAL SPECIFICITY FACTOR

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1EV0)

(-) Sites  (0, 0)

(no "Site" information available for 1EV0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EV0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1EV0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EV0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1EV0)

(-) Exons   (0, 0)

(no "Exon" information available for 1EV0)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:58
 aligned with MINE_ECOLI | P0A734 from UniProtKB/Swiss-Prot  Length:88

    Alignment length:58
                                    40        50        60        70        80        
            MINE_ECOLI   31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88
               SCOP domains d1ev0a_ A:                                                 SCOP domains
               CATH domains 1ev0A00 A:31-88 Cell Cycle Chain A                         CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..hhhhhhhhhhhhhhhhh..hhh.eeeeeeee...eeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                  1ev0 A 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88
                                    40        50        60        70        80        

Chain B from PDB  Type:PROTEIN  Length:58
 aligned with MINE_ECOLI | P0A734 from UniProtKB/Swiss-Prot  Length:88

    Alignment length:58
                                    40        50        60        70        80        
            MINE_ECOLI   31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88
               SCOP domains d1ev0b_ B:                                                 SCOP domains
               CATH domains 1ev0B00 B:31-88 Cell Cycle Chain A                         CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..hhhhhhhhhhhhhhhhh..hhh.eeeeeeee...eeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                  1ev0 B 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88
                                    40        50        60        70        80        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EV0)

(-) Gene Ontology  (9, 9)

NMR Structure(hide GO term definitions)
Chain A,B   (MINE_ECOLI | P0A734)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0000918    barrier septum site selection    The process of marking the site where a barrier septum will form.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0032955    regulation of barrier septum assembly    Any process that modulates the frequency, rate or extent of barrier septum formation. Barrier septum formation is the assembly and arrangement of a septum that spans the plasma membrane interface between progeny cells following cytokinesis.
    GO:0051302    regulation of cell division    Any process that modulates the frequency, rate or extent of the physical partitioning and separation of a cell into daughter cells.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ev0)
 
  Sites
(no "Sites" information available for 1ev0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ev0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ev0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MINE_ECOLI | P0A734
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MINE_ECOLI | P0A734
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MINE_ECOLI | P0A7343r9i 3r9j

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1EV0)