1CNS - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CHITINASE AT 1.91A RESOLUTION

Authors :   H. K. Song, S. W. Suh

Date :   24 Jun 95 (Deposition) - 29 Jan 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.91

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Alpha-Helical Structure, Anti-Fungal Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. K. Song, S. W. Suh
Refined Structure Of The Chitinase From Barley Seeds At 2. 0 A Resolution.
Acta Crystallogr. , Sect. D V. 52 289 1996
PubMed-ID: 15299702 | Reference-DOI: 10.1107/S0907444995009061
(for further references see the PDB file header)

Molecule 1 - CHITINASE
	Chains	:	A, B
	EC Number	:	3.2.1.14
	Organ	:	SEED
	Organism Scientific	:	HORDEUM VULGARE
	Organism Taxid	:	4513
	Tissue	:	SEEDS

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1CNS)

(no "Site" information available for 1CNS)

Asymmetric Unit

No.	Residues
1	A:23	-	A:85
2	A:97	-	A:105
3	A:204	-	A:236
4	B:23	-	B:85
5	B:97	-	B:105
6	B:204	-	B:236

Asymmetric Unit

No.	Residues
1	Pro A:163	-	Pro A:164
2	Pro B:163	-	Pro B:164

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CHI2_HORVU_001 *	D	205	S	CHI2_HORVU	---	---	A/B	D	182	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CHI2_HORVU_001 *	D	205	S	CHI2_HORVU	---	---	A	D	182	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CHI2_HORVU_001 *	D	205	S	CHI2_HORVU	---	---	B	D	182	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHITINASE_19_1	PS00773	Chitinases family 19 signature 1.	CHI2_HORVU	46-68	2	A:23-45 B:23-45
2	CHITINASE_19_2	PS00774	Chitinases family 19 signature 2.	CHI2_HORVU	172-182	2	A:149-159 B:149-159

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHITINASE_19_1	PS00773	Chitinases family 19 signature 1.	CHI2_HORVU	46-68	1	A:23-45 -
2	CHITINASE_19_2	PS00774	Chitinases family 19 signature 2.	CHI2_HORVU	172-182	1	A:149-159 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHITINASE_19_1	PS00773	Chitinases family 19 signature 1.	CHI2_HORVU	46-68	1	- B:23-45
2	CHITINASE_19_2	PS00774	Chitinases family 19 signature 2.	CHI2_HORVU	172-182	1	- B:149-159

(no "Exon" information available for 1CNS)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:243
 aligned with CHI2_HORVU | P23951 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:243
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263   
           CHI2_HORVU    24 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFPGFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVGFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA 266
               SCOP domains d1cnsa_ A: Plant class II chitinase                                                                                                                                                                                                                 SCOP domains
               CATH domains 1cnsA01 A:1-87,A:146-243  [code=1.10.530.10, no name defined]                          1cnsA02 A:88-145 Endochitinase, domain 2                  1cnsA01 A:1-87,A:146-243  [code=1.10.530.10, no name defined]                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh..hhhhhhhhhh.............hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..........hhh........................................hhhhhhhhhhh.........hhhh.hhhhhhhhhhhhh.......hhhhhhhh.....hhhhhh.....hhhhhhhh...........hhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------CHITINASE_19_1         -------------------------------------------------------------------------------------------------------CHITINASE_1------------------------------------------------------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cns A   1 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFSGFGTTGSADVQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVSFKTAMWFWMTAQPPKPSSHAVIVGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with CHI2_HORVU | P23951 from UniProtKB/Swiss-Prot  Length:266

    Alignment length:243
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263   
           CHI2_HORVU    24 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFPGFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVGFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA 266
               SCOP domains d1cnsb_ B: Plant class II chitinase                                                                                                                                                                                                                 SCOP domains
               CATH domains 1cnsB01 B:1-87,B:146-243  [code=1.10.530.10, no name defined]                          1cnsB02 B:88-145 Endochitinase, domain 2                  1cnsB01 B:1-87,B:146-243  [code=1.10.530.10, no name defined]                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh..hhhhhhhhhh.............hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..........hhh........................................hhhhhhhhhhh.........hhhh.hhhhhhhhhhhhh.......hhhhhhhh.....hhhhhh.....hhhhhhhh...........hhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------CHITINASE_19_1         -------------------------------------------------------------------------------------------------------CHITINASE_1------------------------------------------------------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cns B   1 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFSGFGTTGSADVQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVSFKTAMWFWMTAQPPKPSSHAVIVGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Lysozyme-like (1361)

Superfamily: Lysozyme-like (1361)

Family: Family 19 glycosidase (12)

Protein domain: Plant class II chitinase (3)

Barley (Hordeum vulgare) [TaxId: 4513] (2)

1a	d1cnsa_	A:
1b	d1cnsb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Endochitinase; domain 2 (16)

Homologous Superfamily: Endochitinase, domain 2 (16)

Hordeum vulgare. Organism_taxid: 4513. (2)

1a	1cnsA02	A:88-145
1b	1cnsB02	B:88-145

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Lysozyme (1131)

Homologous Superfamily: [code=1.10.530.10, no name defined] (605)

Hordeum vulgare. Organism_taxid: 4513. (2)

2a	1cnsA01	A:1-87,A:146-243
2b	1cnsB01	B:1-87,B:146-243

(no "Pfam Domain" information available for 1CNS)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CHI2_HORVU | P23951)

molecular function
	GO:0004568	chitinase activity	Catalysis of the hydrolysis of (1->4)-beta linkages of N-acetyl-D-glucosamine (GlcNAc) polymers of chitin and chitodextrins.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016798	hydrolase activity, acting on glycosyl bonds	Catalysis of the hydrolysis of any glycosyl bond.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0016998	cell wall macromolecule catabolic process	The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
	GO:0006032	chitin catabolic process	The chemical reactions and pathways resulting in the breakdown of chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
	GO:0006952	defense response	Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0000272	polysaccharide catabolic process	The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cns)

	Sites
(no "Sites" information available for 1cns)

	Cis Peptide Bonds
		Pro A:163 - Pro A:164	[ RasMol ]
		Pro B:163 - Pro B:164	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Prepi
	C alpha wire, SS bonds, labeling, chain-specific coloring, sequence [ mono GIF format \| stereo GIF format ]
	spacefill, chain-specific coloring [ mono GIF format \| stereo GIF format ]

Access by PDB/NDB ID
	1cns
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CHI2_HORVU \| P23951
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.2.1.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CHI2_HORVU \| P23951
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CHI2_HORVU \| P23951	:	2baa

(no "Related Entries Specified in the PDB File" available for 1CNS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File