|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1CIX) |
Sites (0, 0)| (no "Site" information available for 1CIX) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1CIX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1CIX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1CIX) |
Exons (0, 0)| (no "Exon" information available for 1CIX) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:44 aligned with TACA2_TACTR | Q9U8X3 from UniProtKB/Swiss-Prot Length:67 Alignment length:44 33 43 53 63 TACA2_TACTR 24 YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY 67 SCOP domains d1cixa_ A: Tachystatin SCOP domains CATH domains 1cixA00 A:1-44 CATH domains Pfam domains -------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------- PROSITE Transcript -------------------------------------------- Transcript 1cix A 1 YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY 44 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1CIX) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (TACA2_TACTR | Q9U8X3)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|