Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CONOTOXIN GS, NMR, 20 STRUCTURES
 
Authors :  J. M. Hill, P. F. Alewood, D. J. Craik
Date :  03 Apr 97  (Deposition) - 08 Apr 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Neurotoxin, Mu-Conotoxin, Sodium Channel Blocker, Cystine Knot Motif (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. M. Hill, P. F. Alewood, D. J. Craik
Solution Structure Of The Sodium Channel Antagonist Conotoxin Gs: A New Molecular Caliper For Probing Sodium Channel Geometry.
Structure V. 5 571 1997
PubMed-ID: 9115446  |  Reference-DOI: 10.1016/S0969-2126(97)00212-8
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CONOTOXIN GS
    Chains: A
    Engineered: YES
    Organism Common: GEOGRAPHY CONE
    Organism Scientific: CONUS GEOGRAPHUS
    Organism Taxid: 6491

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

NMR Structure (2, 3)
No.NameCountTypeFull Name
1CGU1Mod. Amino AcidGAMMA-CARBOXY-GLUTAMIC ACID
2HYP2Mod. Amino Acid4-HYDROXYPROLINE

(-) Sites  (0, 0)

(no "Site" information available for 1AG7)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:2 -A:14
2A:9 -A:19
3A:13 -A:27

(-) Cis Peptide Bonds  (2, 40)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Cys A:9 -Hyp A:10
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Asn A:23 -Pro A:24

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AG7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AG7)

(-) Exons   (0, 0)

(no "Exon" information available for 1AG7)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:34
 aligned with CGS_CONGE | P15472 from UniProtKB/Swiss-Prot  Length:34

    Alignment length:34
                                    10        20        30    
             CGS_CONGE    1 ACSGRGSRCPPQCCMGLRCGRGNPQKCIGAHEDV 34
               SCOP domains d1ag7a_ A: Conotoxin               SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ................eeee.....eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                  1ag7 A  1 ACSGRGSRCppQCCMGLRCGRGNPQKCIGAHeDV 34
                                    10|       20        30 |  
                                    10-HYP                32-CGU
                                     11-HYP
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1AG7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AG7)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (CGS_CONGE | P15472)
molecular function
    GO:0019871    sodium channel inhibitor activity    Stops, prevents, or reduces the activity of a sodium channel.
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CGU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HYP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1ag7)
 
  Cis Peptide Bonds
    Asn A:23 - Pro A:24   [ RasMol ]  
    Cys A:9 - Hyp A:10   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ag7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CGS_CONGE | P15472
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CGS_CONGE | P15472
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AG7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AG7)