|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1A1T) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1A1T) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1A1T) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1A1T) |
Exons (0, 0)| (no "Exon" information available for 1A1T) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:55 aligned with Q75677_9HIV1 | Q75677 from UniProtKB/TrEMBL Length:107 Alignment length:55 10 20 30 40 50 Q75677_9HIV1 1 MQRGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQAN 55 SCOP domains d1a1ta_ A: HIV nucleocapsid SCOP domains CATH domains 1a1tA00 A:1-55 HIV-1 Nucleocapsid Protein CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------- PROSITE Transcript ------------------------------------------------------- Transcript 1a1t A 1 MQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQAN 55 10 20 30 40 50
Chain B from PDB Type:RNA Length:20
1a1t B 201 GGACUAGCGGAGGCUAGUCC 220
210 220
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1A1T) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (Q75677_9HIV1 | Q75677)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|