Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theoretical Model
collapse expand < >
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  THEORETICAL MODEL OF RET_HUMAN
 
Authors :  S. Costantini
Date :  08 Oct 04  (Deposition) - 19 Oct 04  (Release) - 19 Oct 04  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Ret Human (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Costantini
Homology Modelling Of Ret Human Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
    ChainsA
    EC Number2.7.1.112
    FragmentFRAGMENT 709-1013
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    SynonymC-RET

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XPD)

(-) Sites  (0, 0)

(no "Site" information available for 1XPD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XPD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XPD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (33, 33)

Theoretical Model (33, 33)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_041765R749TRET_HUMANPolymorphism34288963AR40T
02UniProtVAR_009481E762QRET_HUMANDisease (HSCR1)  ---AE53Q
03UniProtVAR_009493S765PRET_HUMANDisease (HSCR1)75075748AS56P
04UniProtVAR_006334S767RRET_HUMANDisease (HSCR1)  ---AS58R
05UniProtVAR_006335E768DRET_HUMANDisease (MTC)78014899AE59D
06UniProtVAR_044395V778IRET_HUMANUnclassified75686697AV69I
07UniProtVAR_067119N783SRET_HUMANDisease (HSCR1)587778656AN74S
08UniProtVAR_009482L790FRET_HUMANDisease (MEN2A)75030001AL81F
09UniProtVAR_009483Y791FRET_HUMANDisease (PCC)77724903AY82F
10UniProtVAR_006336V804LRET_HUMANDisease (MTC)79658334AV95L
11UniProtVAR_006337V804MRET_HUMANDisease (MTC)79658334AV95M
12UniProtVAR_009484R813QRET_HUMANDisease (HSCR1)  ---AR104Q
13UniProtVAR_041766Y826SRET_HUMANPolymorphism34617196AY117S
14UniProtVAR_067120G830RRET_HUMANDisease (HSCR1)200127630AG121R
15UniProtVAR_011582R844LRET_HUMANDisease (MTC)55947360AR135L
16UniProtVAR_006338R873QRET_HUMANDisease (HSCR1)  ---AR164Q
17UniProtVAR_009485A883FRET_HUMANDisease (MEN2B)377767429AA174F
18UniProtVAR_009486S891ARET_HUMANDisease (MTC)75234356AS182A
19UniProtVAR_006339F893LRET_HUMANDisease (HSCR1)  ---AF184L
20UniProtVAR_044396G894SRET_HUMANUnclassified  ---AG185S
21UniProtVAR_006340R897QRET_HUMANDisease (HSCR1)76087194AR188Q
22UniProtVAR_006341K907ERET_HUMANDisease (HSCR1)377767430AK198E
23UniProtVAR_067121K907TRET_HUMANDisease (HSCR1)  ---AK198T
24UniProtVAR_006342M918TRET_HUMANDisease (MEN2B)74799832AM209T
25UniProtVAR_006343E921KRET_HUMANDisease (HSCR1)  ---AE212K
26UniProtVAR_012745S922FRET_HUMANDisease (MTC)377767432AS213F
27UniProtVAR_009487S922YRET_HUMANPolymorphism377767432AS213Y
28UniProtVAR_006345T946MRET_HUMANDisease (MEN2B)  ---AT237M
29UniProtVAR_067122F961LRET_HUMANDisease (HSCR1)  ---AF252L
30UniProtVAR_006346R972GRET_HUMANDisease (HSCR1)76534745AR263G
31UniProtVAR_006347P973LRET_HUMANDisease (HSCR1)  ---AP264L
32UniProtVAR_006348M980TRET_HUMANDisease (HSCR1)  ---AM271T
33UniProtVAR_006349R982CRET_HUMANPolymorphism17158558AR273C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Theoretical Model (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.RET_HUMAN730-758  1A:21-49
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.RET_HUMAN870-882  1A:161-173

(-) Exons   (8, 8)

Theoretical Model (8, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003557101aENSE00001948565chr10:43572475-43572779305RET_HUMAN1-25250--
1.2ENST000003557102ENSE00001365997chr10:43595907-43596170264RET_HUMAN25-113890--
1.3ENST000003557103ENSE00001095923chr10:43597790-43598077288RET_HUMAN113-209970--
1.4bENST000003557104bENSE00001095946chr10:43600400-43600641242RET_HUMAN209-289810--
1.5bENST000003557105bENSE00001095907chr10:43601824-43602019196RET_HUMAN290-355660--
1.6ENST000003557106ENSE00001095904chr10:43604479-43604678200RET_HUMAN355-421670--
1.7ENST000003557107ENSE00001312192chr10:43606655-43606913259RET_HUMAN422-508870--
1.8ENST000003557108ENSE00001164816chr10:43607547-43607672126RET_HUMAN508-550430--
1.9ENST000003557109ENSE00001164807chr10:43608301-43608411111RET_HUMAN550-587380--
1.10ENST0000035571010ENSE00001164798chr10:43609004-43609123120RET_HUMAN587-627410--
1.11bENST0000035571011bENSE00001164787chr10:43609928-43610184257RET_HUMAN627-712861A:1-33
1.12ENST0000035571012ENSE00001095944chr10:43612032-43612179148RET_HUMAN713-762501A:4-5350
1.13ENST0000035571013ENSE00001164770chr10:43613821-43613928108RET_HUMAN762-798371A:53-8937
1.14ENST0000035571014ENSE00001164762chr10:43614979-43615193215RET_HUMAN798-869721A:89-16072
1.15ENST0000035571015ENSE00001239109chr10:43615529-43615651123RET_HUMAN870-910411A:161-20141
1.16ENST0000035571016ENSE00001095916chr10:43617394-4361746471RET_HUMAN911-934241A:202-22524
1.17ENST0000035571017ENSE00001164739chr10:43619119-43619256138RET_HUMAN934-980471A:225-27147
1.18ENST0000035571018ENSE00001164730chr10:43620331-43620430100RET_HUMAN980-1013341A:271-30434
1.19aENST0000035571019aENSE00001095931chr10:43622023-43622170148RET_HUMAN1014-1063500--
1.20ENST0000035571020ENSE00001386034chr10:43623560-436257992240RET_HUMAN1063-1114520--

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:304
 aligned with RET_HUMAN | P07949 from UniProtKB/Swiss-Prot  Length:1114

    Alignment length:304
                                   719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929       939       949       959       969       979       989       999      1009    
           RET_HUMAN    710 KILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR 1013
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhh.eeeeeee......eeeeeee.........eeeeeee.....hhhhhhhhhhhhhhhhhh.......eeeee......eeee.....eehhhhhhhh...........................hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......................hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------T------------Q--P-RD---------I----S------FF------------L--------Q------------S---R-------------L----------------------------Q---------F-------A-LS--Q---------E----------T--KF-----------------------M--------------L----------GL------T-C------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------T--------------Y------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------PROTEIN_KINASE_ATP           ---------------------------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1Exon 1.12  PDB: A:4-53 UniProt: 713-762           -----------------------------------Exon 1.14  PDB: A:89-160 UniProt: 798-869                               Exon 1.15  PDB: A:161-201                Exon 1.16  PDB: A:202-22---------------------------------------------Exon 1.18  PDB: A:271-304          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.13  PDB: A:53-89              ---------------------------------------------------------------------------------------------------------------------------------------Exon 1.17  PDB: A:225-271 UniProt: 934-980     --------------------------------- Transcript 1 (2)
                1xpd A    1 KILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR  304
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1XPD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1XPD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1XPD)

(-) Gene Ontology  (64, 64)

Theoretical Model(hide GO term definitions)
Chain A   (RET_HUMAN | P07949)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0061146    Peyer's patch morphogenesis    The process in which a Peyer's patch is generated and organized. Peyer's patches are typically found as nodules associated with gut epithelium with distinct internal structures including B- and T-zones for the activation of lymphocytes.
    GO:0006919    activation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0071300    cellular response to retinoic acid    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
    GO:0001838    embryonic epithelial tube formation    The morphogenesis of an embryonic epithelium into a tube-shaped structure.
    GO:0048484    enteric nervous system development    The process whose specific outcome is the progression of the enteric nervous system over time, from its formation to the mature structure. The enteric nervous system is composed of two ganglionated neural plexuses in the gut wall which form one of the three major divisions of the autonomic nervous system. The enteric nervous system innervates the gastrointestinal tract, the pancreas, and the gall bladder. It contains sensory neurons, interneurons, and motor neurons. Thus the circuitry can autonomously sense the tension and the chemical environment in the gut and regulate blood vessel tone, motility, secretions, and fluid transport. The system is itself governed by the central nervous system and receives both parasympathetic and sympathetic innervation.
    GO:0007156    homophilic cell adhesion via plasma membrane adhesion molecules    The attachment of a plasma membrane adhesion molecule in one cell to an identical molecule in an adjacent cell.
    GO:0060384    innervation    The process in which a nerve invades a tissue and makes functional synaptic connection within the tissue.
    GO:0097021    lymphocyte migration into lymphoid organs    The movement of a lymphocyte within the lymphatic system into lymphoid organs such as lymph nodes, spleen or Peyer's patches, and its subsequent positioning within defined functional compartments such as sites of cell activation by antigen.
    GO:0033619    membrane protein proteolysis    The proteolytic cleavage of a transmembrane protein leading to the release of its intracellular or ecto-domains.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0001755    neural crest cell migration    The characteristic movement of cells from the dorsal ridge of the neural tube to a variety of locations in a vertebrate embryo.
    GO:0007158    neuron cell-cell adhesion    The attachment of a neuron to another cell via adhesion molecules.
    GO:0030182    neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
    GO:0042551    neuron maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a neuron to attain its fully functional state.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0033630    positive regulation of cell adhesion mediated by integrin    Any process that activates or increases the frequency, rate, or extent of cell adhesion mediated by integrin.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0045793    positive regulation of cell size    Any process that increases cell size.
    GO:2001241    positive regulation of extrinsic apoptotic signaling pathway in absence of ligand    Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0072300    positive regulation of metanephric glomerulus development    Any process that increases the rate, frequency or extent of metanephric glomerulus development, the progression of the metanephric glomerulus over time from its initial formation until its mature state. The metanephric glomerulus is a capillary tuft surrounded by Bowman's capsule in nephrons of the vertebrate kidney, or metanephros.
    GO:0014042    positive regulation of neuron maturation    Any process that activates or increases the frequency, rate or extent of neuron maturation.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007497    posterior midgut development    The process whose specific outcome is the progression of the posterior midgut over time, from its formation to the mature structure.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0050770    regulation of axonogenesis    Any process that modulates the frequency, rate or extent of axonogenesis, the generation of an axon, the long process of a neuron.
    GO:0030155    regulation of cell adhesion    Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0048265    response to pain    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pain stimulus. Pain stimuli cause activation of nociceptors, peripheral receptors for pain, include receptors which are sensitive to painful mechanical stimuli, extreme heat or cold, and chemical stimuli.
    GO:0060041    retina development in camera-type eye    The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0035799    ureter maturation    A developmental process, independent of morphogenetic (shape) change, that is required for the ureter to attain its fully functional state. The ureter is a muscular tube that transports urine from the kidney to the urinary bladder or from the Malpighian tubule to the hindgut.
    GO:0001657    ureteric bud development    The process whose specific outcome is the progression of the ureteric bud over time, from its formation to the mature structure.
cellular component
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xpd)
 
  Sites
(no "Sites" information available for 1xpd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xpd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xpd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RET_HUMAN | P07949
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.112
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  142623
    Disease InformationOMIM
  155240
    Disease InformationOMIM
  162300
    Disease InformationOMIM
  171300
    Disease InformationOMIM
  171400
    Disease InformationOMIM
 
Access by GenAge ID
  0056
    Age Related InformationGenAge
  0127
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RET_HUMAN | P07949
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RET_HUMAN | P079492ivs 2ivt 2ivu 2ivv 2x2k 2x2l 2x2m 2x2u 4cki 4ckj 4ux8 5amn 5fm2 5fm3

(-) Related Entries Specified in the PDB File

1fgi TEMPLATE FOR HOMOLOGY MODELLING