Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  EXTRAGENIC SUPPRESSOR FROM PYROCOCCUS FURIOSUS PFU-1862794-001
 
Authors :  M. Zhao, J. C. Chang, W. Zhou, L. Chen, P. Horanyi, H. Xu, H. Yang, Z. - J. Liu, J. E. Habel, D. Lee, S. -H. Chang, J. P. Rose, B. -C. Wang, Southeast Collaboratory For Structural Genomics (Secsg)
Date :  21 Sep 04  (Deposition) - 30 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Structural Genomics, Pyrococcus Furiosus, Extragenic Suppressor, Southeast Collaboratory For Structural Genomics, Hyperthermophile, Psi, Protein Structure Initiative, Secsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Zhao, J. C. Chang, W. Zhou, L. Chen, P. Horanyi, H. Xu, H. Yang, Z. -J. Liu, J. E. Habel, D. Lee, S. -H. Chang, J. P. Rose, B. -C. Wang, Southeast Collaboratory For Structural Genomics
Extragenic Suppressor From Pyrococcus Furiosus Pfu-1862794-001
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EXTRAGENIC SUPPRESSOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24D BAM
    Expression System Strain: BL21 STAR DE3 PRIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: PYROCOCCUS FURIOSUS
    Organism Taxid: 2261

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XI6)

(-) Sites  (0, 0)

(no "Site" information available for 1XI6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XI6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XI6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XI6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XI6)

(-) Exons   (0, 0)

(no "Exon" information available for 1XI6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:234
 aligned with Q8TZH9_PYRFU | Q8TZH9 from UniProtKB/TrEMBL  Length:254

    Alignment length:249
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241         
         Q8TZH9_PYRFU     2 KLKFWREVAIDIISDFETTIMPFFGNPDGGKLVKISPSGDETKLVDKLAEDLILSRITELGVNVVSEEVGVIDNESEYTVIVDPLDGSYNFIAGIPFFALSLAVFKKDKPIYAIIYEPMTERFFEGIPGEGAFLNGKRIKVRKTPDEKPSISFYSRGKGHEIVKHVKRTRTLGAIALELAYLAMGALDGVVDVRKYVRPTDIAAGTIIAKEAGALIKDSAGKDIDISFNATDRLDVIAVNSEELLKTIL 250
               SCOP domains d1xi6a_ A: Archaeal inositol mono         phosphatase/fructose-1,6-bisphosphatase                                                                                                                                                                         SCOP domains
               CATH domains 1xi6A01 A:2-140 Fructose-1,6-Bisp         hosphatase, subunit A, domain 1                                                                  1xi6      A02 A:141-250  [code=3.40.190.80, no name defined]                                                   CATH domains
               Pfam domains Inositol_P-1xi6A01 A:2-250                                                                                                                                                                                                                                Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh..---------hhhhhhhhhhhhhhhhhhh.eeee...eee.....eeeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.....------.eeee.......hhhhh..ee...hhhhhhhhhhhh...eeeeeeeeehhhhhhhhhhhhhh...eee................eeeeee.hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xi6 A   2 KLKFWREVAIDIISDFETTIMPFFGNPDGGKLV---------KLVDKLAEDLILSRITELGVNVVSEEVGVIDNESEYTVIVDPLDGSYNFIAGIPFFALSLAVFKKDKPIYAIIYEPMTERFFEGIPGEGAFLNGKRIKVRK------SISFYSRGKGHEIVKHVKRTRTLGAIALELAYLAMGALDGVVDVRKYVRPTDIAAGTIIAKEAGALIKDSAGKDIDISFNATDRLDVIAVNSEELLKTIL 250
                                    11        21        31  |      -  |     51        61        71        81        91       101       111       121       131       141  |    151       161       171       181       191       201       211       221       231       241         
                                                           34        44                                                                                                 144    151
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Multi-domain proteins (alpha and beta) (2421)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Phospoesterase (42)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8TZH9_PYRFU | Q8TZH9)
biological process
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xi6)
 
  Sites
(no "Sites" information available for 1xi6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xi6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xi6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8TZH9_PYRFU | Q8TZH9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8TZH9_PYRFU | Q8TZH9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XI6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XI6)