|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1V9Y) |
(no "Cis Peptide Bond" information available for 1V9Y) |
(no "SAP(SNP)/Variant" information available for 1V9Y) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1V9Y) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:103 aligned with DOSP_ECOLI | P76129 from UniProtKB/Swiss-Prot Length:799 Alignment length:113 21 31 41 51 61 71 81 91 101 111 121 DOSP_ECOLI 12 GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD 124 SCOP domains d1v9ya_ A: Direct oxygen sensor protein, DOS SCOP domains CATH domains 1v9yA00 A:20-132 [code=3.30.450.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----PAS PDB: A:25-72 UniProt: 17-64 ------------------------------------------------------------ PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 1v9y A 20 GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRE----------RELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD 132 29 39 49 59 69 79 | - |99 109 119 129 86 97 Chain B from PDB Type:PROTEIN Length:103 aligned with DOSP_ECOLI | P76129 from UniProtKB/Swiss-Prot Length:799 Alignment length:113 21 31 41 51 61 71 81 91 101 111 121 DOSP_ECOLI 12 GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD 124 SCOP domains d1v9yb_ B: Direct oxygen sensor protein, DOS SCOP domains CATH domains 1v9yB00 B:20-132 [code=3.30.450.20, no name defined] CATH domains Pfam domains (1) ----------PAS_9-1v9yB01 B:30-132 Pfam domains (1) Pfam domains (2) ----------PAS_9-1v9yB02 B:30-132 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----PAS PDB: B:25-72 UniProt: 17-64 ------------------------------------------------------------ PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 1v9y B 20 GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRE----------RELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD 132 29 39 49 59 69 79 | - |99 109 119 129 86 97
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (DOSP_ECOLI | P76129)
|
|
|
|
|
|
|