1V95 - JenaLib

Title :   SOLUTION STRUCTURE OF ANTICODON BINDING DOMAIN FROM NUCLEAR RECEPTOR COACTIVATOR 5 (HUMAN KIAA1637 PROTEIN)

Authors :   C. Zhao, T. Kigawa, N. Tochio, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   20 Jan 04 (Deposition) - 20 Jul 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Nuclear Receptor Coactivator 5, Coactivator Independent Of Af-2 Function (Cia), Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Zhao, T. Kigawa, N. Tochio, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of Anticodon Binding Domain From Nuclear Receptor Coactivator 5 (Human Kiaa1637 Protein)
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000290231	1	ENSE00001525079	chr20:44718591-44718456	136	NCOA5_HUMAN	-	0	0	-	-
1.2	ENST00000290231	2	ENSE00001753187	chr20:44708092-44708026	67	NCOA5_HUMAN	1-13	13	0	-	-
1.3	ENST00000290231	3	ENSE00001665164	chr20:44699175-44698849	327	NCOA5_HUMAN	13-122	110	0	-	-
1.4	ENST00000290231	4	ENSE00000662541	chr20:44697277-44697141	137	NCOA5_HUMAN	122-168	47	1	A:1-4	4
1.5	ENST00000290231	5	ENSE00002173229	chr20:44695820-44695694	127	NCOA5_HUMAN	168-210	43	1	A:5-21	17
1.6	ENST00000290231	6	ENSE00001672871	chr20:44693867-44693668	200	NCOA5_HUMAN	210-277	68	1	A:21-88	68
1.7	ENST00000290231	7	ENSE00001612661	chr20:44692319-44691999	321	NCOA5_HUMAN	277-384	108	1	A:88-130 (gaps)	57
1.8	ENST00000290231	8	ENSE00001457437	chr20:44691528-44689624	1905	NCOA5_HUMAN	384-579	196	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:130
 aligned with NCOA5_HUMAN | Q9HCD5 from UniProtKB/Swiss-Prot  Length:579

    Alignment length:178
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325        
          NCOA5_HUMAN   156 GPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEG 333
               SCOP domains d1v9                                  5a_ A: Nuclear receptor coactivator 5 (KIAA1637)                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....----------------------------------......eeeeee..hhhhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhh..eeeeehhhhhhh.eeeeee......eeeeeehhhhhhhhhhhhhhhhhhhhh...........--------------..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4     -----------------------------------------Exon 1.6  PDB: A:21-88 UniProt: 210-277                             -------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.5  PDB: A:5-21 UniProt: 168-210     ------------------------------------------------------------------Exon 1.7  PDB: A:88-130 (gaps) UniProt: 277-384           Transcript 1 (2)
                 1v95 A   1 GSSG----------------------------------SSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAS--------------GPSSG 130
                               |     -         -         -        |6        16        26        36        46        56        66        76        86        96       106       116        |-         -   |    
                               4                                  5                                                                                                                     125            126

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (NCOA5_HUMAN | Q9HCD5)

molecular function
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0042593	glucose homeostasis	Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
	GO:0046627	negative regulation of insulin receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of insulin receptor signaling.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1v95)

	Sites
(no "Sites" information available for 1v95)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1v95)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1v95
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCOA5_HUMAN \| Q9HCD5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NCOA5_HUMAN \| Q9HCD5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description