Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN FEN1-PCNA COMPLEX
 
Authors :  S. Sakurai, K. Kitano, H. Yamaguchi, K. Hamada, K. Okada, K. Fukuda, M. Uchida, E. Ohtsuka, H. Morioka, T. Hakoshima
Date :  05 Sep 03  (Deposition) - 01 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B,C,X,Y,Z
Keywords :  Protein Complex, Dna-Binding Protein, Flap Dna, Flap Endonuclease, Sliding Clamp, Dna Clamp, Replication, Dna Repair, Hydrolase/Dna Binding Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Sakurai, K. Kitano, H. Yamaguchi, K. Okada, K. Hamada, K. Fukuda, M. Uchida, E. Ohtsuka, H. Morioka, T. Hakoshima
Structural Basis For Recruitment Of Human Flap Endonuclease 1 To Pcna
Embo J. V. 24 683 2005
PubMed-ID: 15616578  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600519
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FLAP ENDONUCLEASE-1
    ChainsX, Y, Z
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-22B(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMATURATION FACTOR 1, MF1
 
Molecule 2 - PROLIFERATING CELL NUCLEAR ANTIGEN
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPGEMEX-1
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPCNA, CYCLIN

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCXYZ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MG4Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP X:34 , ASP X:86 , GLU X:158 , GLU X:160 , MG X:1002BINDING SITE FOR RESIDUE MG X 1001
2AC2SOFTWAREGLU X:158 , GLU X:160 , ASP X:181 , TYR X:234 , MG X:1001BINDING SITE FOR RESIDUE MG X 1002
3AC3SOFTWAREGLU Y:158 , MG Y:1004BINDING SITE FOR RESIDUE MG Y 1003
4AC4SOFTWAREGLU Y:160 , ASP Y:181 , ASP Y:233 , MG Y:1003BINDING SITE FOR RESIDUE MG Y 1004

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1B:135 -B:162

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UL1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 3)

Asymmetric/Biological Unit (1, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_071871S228IPCNA_HUMANDisease (ATLD2)369958038A/B/CS228I

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 12)

Asymmetric/Biological Unit (4, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PCNA_1PS01251 Proliferating cell nuclear antigen signature 1.PCNA_HUMAN34-57
 
 
  3A:34-57
B:34-57
C:34-57
2PCNA_2PS00293 Proliferating cell nuclear antigen signature 2.PCNA_HUMAN61-79
 
 
  3A:61-79
B:61-79
C:61-79
3XPG_1PS00841 XPG protein signature 1.FEN1_HUMAN79-93
 
 
  3X:79-93
Y:79-93
Z:79-93
4XPG_2PS00842 XPG protein signature 2.FEN1_HUMAN149-163
 
 
  3X:149-163
Y:149-163
Z:149-163

(-) Exons   (7, 21)

Asymmetric/Biological Unit (7, 21)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003058851ENSE00001224079chr11:61560150-61560500351FEN1_HUMAN-00--
1.2ENST000003058852ENSE00001327269chr11:61562813-615647081896FEN1_HUMAN1-3873873X:2-357 (gaps)
Y:2-359 (gaps)
Z:2-356 (gaps)
356
358
355

2.1ENST000003791601ENSE00001480155chr20:5107272-5107146127PCNA_HUMAN-00--
2.2bENST000003791602bENSE00001480145chr20:5100560-5100224337PCNA_HUMAN1-74743A:1-74
B:1-74
C:1-74
74
74
74
2.3ENST000003791603ENSE00001747465chr20:5099512-509941598PCNA_HUMAN74-107343A:74-107
B:74-107
C:74-107
34
34
34
2.4ENST000003791604ENSE00001693283chr20:5099323-509925668PCNA_HUMAN107-129233A:107-129
B:107-129
C:107-129
23
23
23
2.5ENST000003791605ENSE00000906721chr20:5098310-5098116195PCNA_HUMAN130-194653A:130-194 (gaps)
B:130-194
C:130-194
65
65
65
2.6ENST000003791606ENSE00000906720chr20:5096218-5096095124PCNA_HUMAN195-236423A:195-236
B:195-236
C:195-236
42
42
42
2.7ENST000003791607ENSE00000906719chr20:5096008-5095599410PCNA_HUMAN236-261263A:236-259
B:236-258
C:236-255
24
23
20

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:256
 aligned with PCNA_HUMAN | P12004 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:259
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250         
           PCNA_HUMAN     1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259
               SCOP domains d1ul1a1 A:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1ul1a2 A:127-259 Proliferating cell nuclear antigen (PCNA)                                                                           SCOP domains
               CATH domains 1ul1A00 A:1-259  [code=3.70.10.10, no name defined]                                                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhh......eeeeee...eeeeeee.....eeeeeeee.hhh.eeee...eeeeeehhhhhhhhh......eeeeee.....eeeeeee.....eeeeeeee....eeeeee........eeeeehhhhhhhhhhhhhhh.eeeeee...eeeeeeee..eeeeeeee...---......ee.....eeeeeehhhhhhhhhhhhhh.eeeee......eeeeeee...eeeeeee........ Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------PCNA_1  PDB: A:34-57    ---PCNA_2  PDB: A:61-7------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.2b  PDB: A:1-74 UniProt: 1-74                                      --------------------------------Exon 2.4  PDB: A:107-12Exon 2.5  PDB: A:130-194 (gaps) UniProt: 130-194                 Exon 2.6  PDB: A:195-236 UniProt: 195-236 ----------------------- Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------------------------Exon 2.3  PDB: A:74-107           --------------------------------------------------------------------------------------------------------------------------------Exon 2.7  PDB: A:236-259 Transcript 2 (2)
                 1ul1 A   1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTS---KEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     | 190       200       210       220       230       240       250         
                                                                                                                                                                                                                   186 190                                                                     

Chain B from PDB  Type:PROTEIN  Length:258
 aligned with PCNA_HUMAN | P12004 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:258
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250        
           PCNA_HUMAN     1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDE 258
               SCOP domains d1ul1b1 B:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1ul1b2 B:127-258 Proliferating cell nuclear antigen (PCNA)                                                                          SCOP domains
               CATH domains 1ul1B00 B:1-258  [code=3.70.10.10, no name defined]                                                                                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhh....eeeee...eeeeeee.....eeeeeeee............eeeeehhhhhhhhhh.......eeeee.....eeee........eeeeeeee....eeee.........eeeeeehhhhhhhhhhhh....eeeee....eeeeeeee..eeeeeeee............eeee....eeeeehhhhhhhhhhhhhh.eeeeee.....eeeeeee...eeeeeee....... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------PCNA_1  PDB: B:34-57    ---PCNA_2  PDB: B:61-7----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2b  PDB: B:1-74 UniProt: 1-74                                      --------------------------------Exon 2.4  PDB: B:107-12Exon 2.5  PDB: B:130-194 UniProt: 130-194                        Exon 2.6  PDB: B:195-236 UniProt: 195-236 ---------------------- Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------------------------Exon 2.3  PDB: B:74-107           --------------------------------------------------------------------------------------------------------------------------------Exon 2.7  PDB: B:236-25 Transcript 2 (2)
                 1ul1 B   1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDE 258
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250        

Chain C from PDB  Type:PROTEIN  Length:255
 aligned with PCNA_HUMAN | P12004 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     
           PCNA_HUMAN     1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI 255
               SCOP domains d1ul1c1 C:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1ul1c2 C:127-255 Proliferating cell nuclear antigen (PCNA)                                                                       SCOP domains
               CATH domains 1ul1C00 C:1-255  [code=3.70.10.10, no name defined]                                                                                                                                                                                                             CATH domains
           Pfam domains (1) PCNA_N-1ul1C04 C:1-125                                                                                                       -PCNA_C-1ul1C01 C:127-254                                                                                                        - Pfam domains (1)
           Pfam domains (2) PCNA_N-1ul1C05 C:1-125                                                                                                       -PCNA_C-1ul1C02 C:127-254                                                                                                        - Pfam domains (2)
           Pfam domains (3) PCNA_N-1ul1C06 C:1-125                                                                                                       -PCNA_C-1ul1C03 C:127-254                                                                                                        - Pfam domains (3)
         Sec.struct. author .eeeee..hhhhhhhhhhhhh....eeee....eeeeeee.....eeeeeeee.hhh.eeee....eeeehhhhhhhhhhh.....eeeeee.....eeeeeee.....eeeeeeee....eee..........eeeeeehhhhhhhhhhhh....eeee.....eeeeeeee..eeeeeeee......hhhhh.eeee.....eeeehhhhhhhhhhhhhh.eeeeee.....eeeeeee...eeeeeee.... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I--------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------PCNA_1  PDB: C:34-57    ---PCNA_2  PDB: C:61-7-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2b  PDB: C:1-74 UniProt: 1-74                                      --------------------------------Exon 2.4  PDB: C:107-12Exon 2.5  PDB: C:130-194 UniProt: 130-194                        Exon 2.6  PDB: C:195-236 UniProt: 195-236 ------------------- Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------------------------Exon 2.3  PDB: C:74-107           --------------------------------------------------------------------------------------------------------------------------------Exon 2.7             Transcript 2 (2)
                 1ul1 C   1 MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI 255
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     

Chain X from PDB  Type:PROTEIN  Length:313
 aligned with FEN1_HUMAN | P39748 from UniProtKB/Swiss-Prot  Length:380

    Alignment length:356
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
           FEN1_HUMAN     2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKE 357
               SCOP domains d1ul1x2 X:2-217 Flap endonuclease-1 (Fen-1 nu             clease)                                                                                                                                                       d1ul1x1 X:218-357 Flap endonuclease-1 (Fen-1 nuclease)                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh.......eehhhhhh...eeeehhhhhhhhhh..-------------.hhhhhhhhhhhhhhhhh...eeeee..............-----------------------------........hhhhhhhhhhhhh..eee...hhhhhhhhhhhhh...eee...hhhhhh...eeee......-....eeeeehhhhhhhhh.hhhhhhhhhhhhhh.........hhhhhhhhhhhh.hhhhhhh.............hhhhhhhhhhh....hhhhh.......hhhhhhhhh......hhhhhhhhhhhhhhhhh.....hhhhhheeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------XPG_1          ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------------------------------------------------------------------XPG_2          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
               Transcript 1 Exon 1.2  PDB: X:2-357 (gaps) UniProt: 1-387 [INCOMPLETE]                                                                                                                                                                                                                                                                                                            Transcript 1
                 1ul1 X   2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAV-------------TTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAK-----------------------------RLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASE-KKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKE 357
                                    11        21        31        41    |    -        61        71        81        91       | -         -         -       131       141       151       161       171       181       191      |201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
                                                                       46            60                                     99                           129                                                                  198 |                                                                                                                                                             
                                                                                                                                                                                                                                200                                                                                                                                                             

Chain Y from PDB  Type:PROTEIN  Length:312
 aligned with FEN1_HUMAN | P39748 from UniProtKB/Swiss-Prot  Length:380

    Alignment length:358
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351        
           FEN1_HUMAN     2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPE 359
               SCOP domains d1ul1y2 Y:2-217 Flap endonuclease-1 (Fen-1                nuclease)                                                                                                                                                     d1ul1y1 Y:218-359 Flap endonuclease-1 (Fen-1 nuclease)                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh...eeeehhhhhh..eeeeehhhhhhhhhh---------------.hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh.-------------------------------.hhhhhhhhhhh......eee...hhhhhhhhhhh.....eee...hhhhhh...eeee...........eeeeehhhhhhhh..hhhhhhhhhhhhhh.........hhhhhhhhhhhh.hhhhhhhhh.............hhhhhhh..................hhhhhhh........hhhhhhhhhhhhhhhh...............eeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------XPG_1          -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------------------------------------------------------------------XPG_2          ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
               Transcript 1 Exon 1.2  PDB: Y:2-359 (gaps) UniProt: 1-387 [INCOMPLETE]                                                                                                                                                                                                                                                                                                              Transcript 1
                 1ul1 Y   2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLI---------------TTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSE-------------------------------TKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPE 359
                                    11        21        31        41  |      -        61        71        81        91       101|        -         -         -  |    141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351        
                                                                     44              60                                       102                             134                                                                                                                                                                                                                                 

Chain Z from PDB  Type:PROTEIN  Length:349
 aligned with FEN1_HUMAN | P39748 from UniProtKB/Swiss-Prot  Length:380

    Alignment length:355
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351     
           FEN1_HUMAN     2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRK 356
               SCOP domains d1ul1z2 Z:2-217 Flap endonuclease-1 (Fen-1 nuclease)                                                                                                                                                                    d1ul1z1 Z:218-356 Flap endonuclease-1 (Fen-1 nuclease)                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) XPG_N-1ul1Z04 Z:2-107                                                                                     --------------------------------------XPG_I-1ul1Z01 Z:146-233                                                                 --------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) XPG_N-1ul1Z05 Z:2-107                                                                                     --------------------------------------XPG_I-1ul1Z02 Z:146-233                                                                 --------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) XPG_N-1ul1Z06 Z:2-107                                                                                     --------------------------------------XPG_I-1ul1Z03 Z:146-233                                                                 --------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
         Sec.struct. author ...hhhhhhhhhh...ee..hhhhhh..eeeeehhhhhhhhhh................hhhhhhhhhhhhhhhh...eeeeee.......hhhhh......hhhhhh....------.................hhhhhhhhhhhhh..eee...hhhhhhhhhhhh....eee..hhhhh.....eeee............eeeehhhhhhhhh.hhhhhhhhhhhhhh..........hhhhh...........................hhhhhhhhh...................hhhhhhhh......hhhhhhhhhhhhhh..................eee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------XPG_1          ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------------------------------------------------------------------XPG_2          ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
               Transcript 1 Exon 1.2  PDB: Z:2-356 (gaps) UniProt: 1-387 [INCOMPLETE]                                                                                                                                                                                                                                                                                                           Transcript 1
                 1ul1 Z   2 GIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQ------EQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRK 356
                                    11        21        31        41        51        61        71        81        91       101       111 |     121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351     
                                                                                                                                         113    120                                                                                                                                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (4, 12)

Asymmetric/Biological Unit
(-)
Family: XPG_I (10)
1aXPG_I-1ul1Z01Z:146-233
1bXPG_I-1ul1Z02Z:146-233
1cXPG_I-1ul1Z03Z:146-233
(-)
Clan: PIN (27)

(-) Gene Ontology  (83, 93)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (PCNA_HUMAN | P12004)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0070182    DNA polymerase binding    Interacting selectively and non-covalently with a DNA polymerase.
    GO:0030337    DNA polymerase processivity factor activity    An enzyme regulator activity that increases the processivity of polymerization by DNA polymerase, by allowing the polymerase to move rapidly along DNA while remaining topologically bound to it.
    GO:0032405    MutLalpha complex binding    Interacting selectively and non-covalently with the mismatch repair complex MutLalpha.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0032139    dinucleotide insertion or deletion binding    Interacting selectively and non-covalently with double-stranded DNA containing a dinucleotide insertion or deletion.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0030331    estrogen receptor binding    Interacting selectively and non-covalently with an estrogen receptor.
    GO:0035035    histone acetyltransferase binding    Interacting selectively and non-covalently with the enzyme histone acetyltransferase.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0000701    purine-specific mismatch base pair DNA N-glycosylase activity    Catalysis of the removal of purines present in mismatches, especially opposite oxidized purines, by cleaving the N-C1' glycosidic bond between the target damaged DNA base and the deoxyribose sugar. The reaction releases a free base and leaves an apurinic (AP) site.
    GO:0030971    receptor tyrosine kinase binding    Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
biological process
    GO:0042769    DNA damage response, detection of DNA damage    The series of events required to receive a stimulus indicating DNA damage has occurred and convert it to a molecular signal.
    GO:0006977    DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006271    DNA strand elongation involved in DNA replication    The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0034644    cellular response to UV    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
    GO:0030855    epithelial cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:1902990    mitotic telomere maintenance via semi-conservative replication    Any telomere maintenance via semi-conservative replication that is involved in mitotic cell cycle.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0033683    nucleotide-excision repair, DNA incision    A process that results in the endonucleolytic cleavage of the damaged strand of DNA. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound.
    GO:0006296    nucleotide-excision repair, DNA incision, 5'-to lesion    The endonucleolytic cleavage of the damaged strand of DNA 5' to the site of damage. The incision occurs at the junction of single-stranded DNA and double-stranded DNA that is formed when the DNA duplex is unwound. The incision follows the incision formed 3' to the site of damage.
    GO:0045739    positive regulation of DNA repair    Any process that activates or increases the frequency, rate or extent of DNA repair.
    GO:0045740    positive regulation of DNA replication    Any process that activates or increases the frequency, rate or extent of DNA replication.
    GO:0032077    positive regulation of deoxyribonuclease activity    Any process that activates or increases the frequency, rate or extent of deoxyribonuclease activity, the hydrolysis of ester linkages within deoxyribonucleic acid.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0006275    regulation of DNA replication    Any process that modulates the frequency, rate or extent of DNA replication.
    GO:0000083    regulation of transcription involved in G1/S transition of mitotic cell cycle    Any process that regulates transcription such that the target genes are involved in the transition between G1 and S phase of the mitotic cell cycle.
    GO:0031297    replication fork processing    The process in which a DNA replication fork that has stalled is restored to a functional state and replication is restarted. The stalling may be due to DNA damage, DNA secondary structure, bound proteins, dNTP shortage, or other causes.
    GO:0046686    response to cadmium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
    GO:0033993    response to lipid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipid stimulus.
    GO:0000723    telomere maintenance    Any process that contributes to the maintenance of proper telomeric length and structure by affecting and monitoring the activity of telomeric proteins, the length of telomeric DNA and the replication and repair of the DNA. These processes includes those that shorten, lengthen, replicate and repair the telomeric DNA sequences.
    GO:0000722    telomere maintenance via recombination    Any recombinational process that contributes to the maintenance of proper telomeric length.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
cellular component
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0043626    PCNA complex    A protein complex composed of three identical PCNA monomers, each comprising two similar domains, which are joined in a head-to-tail arrangement to form a homotrimer. Forms a ring-like structure in solution, with a central hole sufficiently large to accommodate the double helix of DNA. Originally characterized as a DNA sliding clamp for replicative DNA polymerases and as an essential component of the replisome, and has also been shown to be involved in other processes including Okazaki fragment processing, DNA repair, translesion DNA synthesis, DNA methylation, chromatin remodeling and cell cycle regulation.
    GO:0070557    PCNA-p21 complex    A protein complex that contains the cyclin-dependent protein kinase inhibitor p21WAF1/CIP1 bound to PCNA; formation of the complex inhibits DNA replication.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0043596    nuclear replication fork    The Y-shaped region of a nuclear replicating DNA molecule, resulting from the separation of the DNA strands and in which the synthesis of new strands takes place. Also includes associated protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0030894    replisome    A multi-component enzymatic machine at the replication fork which mediates DNA replication. Includes DNA primase, one or more DNA polymerases, DNA helicases, and other proteins.

Chain X,Y,Z   (FEN1_HUMAN | P39748)
molecular function
    GO:0008409    5'-3' exonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 5' end.
    GO:0017108    5'-flap endonuclease activity    Catalysis of the cleavage of a 5' flap structure in DNA, but not other DNA structures; processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0004523    RNA-DNA hybrid ribonuclease activity    Catalysis of the endonucleolytic cleavage of RNA in RNA-DNA hybrids to 5'-phosphomonoesters.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0003690    double-stranded DNA binding    Interacting selectively and non-covalently with double-stranded DNA.
    GO:0008309    double-stranded DNA exodeoxyribonuclease activity    Catalysis of the sequential cleavage of mononucleotides from a free 5' or 3' terminus of a double-stranded DNA molecule.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0004527    exonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' or 5' end.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016788    hydrolase activity, acting on ester bonds    Catalysis of the hydrolysis of any ester bond.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0043137    DNA replication, removal of RNA primer    Removal of the Okazaki RNA primer from the lagging strand of replicating DNA, by a combination of the actions of DNA polymerase, DNA helicase and an endonuclease.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0009650    UV protection    Any process in which an organism or cell protects itself from ultraviolet radiation (UV), which may also result in resistance to repeated exposure to UV.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0006302    double-strand break repair    The repair of double-strand breaks in DNA via homologous and nonhomologous mechanisms to reform a continuous DNA helix.
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0007613    memory    The activities involved in the mental information processing system that receives (registers), modifies, stores, and retrieves informational stimuli. The main stages involved in the formation and retrieval of memory are encoding (processing of received information by acquisition), storage (building a permanent record of received information as a result of consolidation) and retrieval (calling back the stored information and use it in a suitable way to execute a given task).
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0000722    telomere maintenance via recombination    Any recombinational process that contributes to the maintenance of proper telomeric length.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ul1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ul1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FEN1_HUMAN | P39748
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PCNA_HUMAN | P12004
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  615919
    Disease InformationOMIM
 
Access by GenAge ID
  0021
    Age Related InformationGenAge
  0034
    Age Related InformationGenAge
  0113
    Age Related InformationGenAge
  0114
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FEN1_HUMAN | P39748
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PCNA_HUMAN | P12004
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FEN1_HUMAN | P397481u7b 3q8k 3q8l 3q8m 3uvu 5e0v 5fv7 5k97 5kse 5um9
        PCNA_HUMAN | P120041axc 1u76 1u7b 1vyj 1vym 1w60 2zvk 2zvl 2zvm 3ja9 3p87 3tbl 3vkx 3wgw 4d2g 4rjf 4ztd 5e0t 5e0u 5e0v 5iy4 5l7c 5mlo 5mlw 5mom

(-) Related Entries Specified in the PDB File

1a76 1axc 1b43