Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN OF UNKNOWN FUNCTION PA1358 FROM PSEUDOMONAS AERUGINOSA
 
Authors :  J. Osipiuk, X. Xu, A. Savchenko, A. Edwards, A. Joachimiak, Midwest Ce Structural Genomics (Mcsg)
Date :  03 Aug 04  (Deposition) - 10 Aug 04  (Release) - 26 Sep 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Hypothetical Protein, Pa1358, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Osipiuk, X. Xu, A. Savchenko, A. Edwards, A. Joachimiak
X-Ray Crystal Structure Of Hypothetical Protein Pa1358 From Pseudomonas Aeruginosa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PA1358
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 208964
    Strain: PAO1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1U7I)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1U7I)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:42 -Pro A:43
2Gly B:42 -Pro B:43

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1U7I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1U7I)

(-) Exons   (0, 0)

(no "Exon" information available for 1U7I)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:134
 aligned with Q9I3Y6_PSEAE | Q9I3Y6 from UniProtKB/TrEMBL  Length:132

    Alignment length:134
                             1                                                                                                                                132 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129  | 
         Q9I3Y6_PSEAE     - -MSARVRPFLMFQGVQAEAAMNFYLSLFDDAEILQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRHAFDFTPAFSFFVDCESNAQIERLAEALSDGGKALMPLGDYGFSQRFAWLADRFGVSWQLNLA-   -
               SCOP domains d1u7ia_ A: Hypothetical protein PA1358                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee..hhhhhhhhhhhhh..eeeeeeee...........eeeeeeee..eeeeeeee...........eeeeee..hhhhhhhhhhhhhh..eeeeeee......eeeeee.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u7i A   0 HmSARVRPFLmFQGVQAEAAmNFYLSLFDDAEILQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRHAFDFTPAFSFFVDCESNAQIERLAEALSDGGKALmPLGDYGFSQRFAWLADRFGVSWQLNLAG 133
                             |       9|       19|       29        39        49        59        69        79        89        99     | 109       119       129    
                             |       10-MSE    20-MSE                                                                              105-MSE                        
                             1-MSE                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:133
 aligned with Q9I3Y6_PSEAE | Q9I3Y6 from UniProtKB/TrEMBL  Length:132

    Alignment length:133
                                                                                                                                                             132 
                                    10        20        30        40        50        60        70        80        90       100       110       120       130 | 
         Q9I3Y6_PSEAE     1 MSARVRPFLMFQGVQAEAAMNFYLSLFDDAEILQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRHAFDFTPAFSFFVDCESNAQIERLAEALSDGGKALMPLGDYGFSQRFAWLADRFGVSWQLNLA-   -
               SCOP domains d1u7ib_ B: Hypothetical protein PA1358                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --3-dmu-9_3-mt-1u7iB01 B:3-130                                                                                                    --- Pfam domains (1)
           Pfam domains (2) --3-dmu-9_3-mt-1u7iB02 B:3-130                                                                                                    --- Pfam domains (2)
         Sec.struct. author ...eeeeeeeee..hhhhhhhhhhhhh..eeeeeeee...........eeeeeeee..eeeeeeee...........eeeeeee.hhhhhhhhhhhhhh..eeeeeee......eeeeee.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u7i B   1 mSARVRPFLmFQGVQAEAAmNFYLSLFDDAEILQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRHAFDFTPAFSFFVDCESNAQIERLAEALSDGGKALmPLGDYGFSQRFAWLADRFGVSWQLNLAG 133
                            |       10        20        30        40        50        60        70        80        90       100    |  110       120       130   
                            1-MSE   10-MSE    20-MSE                                                                              105-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1U7I)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Glyoxalase (58)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1U7I)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1u7i)
 
  Cis Peptide Bonds
    Gly A:42 - Pro A:43   [ RasMol ]  
    Gly B:42 - Pro B:43   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1u7i
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9I3Y6_PSEAE | Q9I3Y6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9I3Y6_PSEAE | Q9I3Y6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1U7I)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1U7I)