Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURES OF THE PHOSPHORYLATED AND UNPHOSPHORYLATED KINASE DOMAINS OF THE CDC42-ASSOCIATED TYROSINE KINASE ACK1 BOUND TO AMP-PCP
 
Authors :  J. C. Lougheed, R. H. Chen, P. Mak, T. J. Stout
Date :  26 Jul 04  (Deposition) - 31 Aug 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Tyrosine Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. C. Lougheed, R. H. Chen, P. Mak, T. J. Stout
Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1.
J. Biol. Chem. V. 279 44039 2004
PubMed-ID: 15308621  |  Reference-DOI: 10.1074/JBC.M406703200

(-) Compounds

Molecule 1 - ACTIVATED CDC42 KINASE 1
    ChainsA
    EC Number2.7.1.112
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF-9
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System VectorPACGP67
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN
    GeneACK1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsPHOSPHORYLATED AT RESIDUE 284
    SynonymACK-1
 
Molecule 2 - ACTIVATED CDC42 KINASE 1
    ChainsB
    EC Number2.7.1.112
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF-9
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System VectorPACGP67
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN
    GeneACK1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsUNPHOSPHORYLATED AT RESIDUE 284
    SynonymACK-1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric Unit (3, 7)
No.NameCountTypeFull Name
1ACP2Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG4Ligand/IonMAGNESIUM ION
3PTR1Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1ACP1Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION
3PTR1Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1ACP1Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION
3PTR-1Mod. Amino AcidO-PHOSPHOTYROSINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREACP A:101 , ASP A:270 , MG A:399BINDING SITE FOR RESIDUE MG A 398
2AC2SOFTWAREACP A:101 , ASN A:257 , ASP A:270 , MG A:398BINDING SITE FOR RESIDUE MG A 399
3AC3SOFTWAREASP B:270 , ACP B:400BINDING SITE FOR RESIDUE MG B 398
4AC4SOFTWAREASN B:257 , ASP B:270 , ACP B:400BINDING SITE FOR RESIDUE MG B 399
5AC5SOFTWAREGLY A:133 , ASP A:134 , VAL A:140 , ALA A:156 , LYS A:158 , GLU A:206 , ALA A:208 , ASN A:257 , LEU A:259 , ASP A:270 , MG A:398 , MG A:399BINDING SITE FOR RESIDUE ACP A 101
6AC6SOFTWARELEU B:132 , GLY B:133 , VAL B:140 , ALA B:156 , LYS B:158 , GLU B:206 , LEU B:207 , ALA B:208 , SER B:212 , ARG B:256 , ASN B:257 , LEU B:259 , ASP B:270 , MG B:398 , MG B:399BINDING SITE FOR RESIDUE ACP B 400

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1U54)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Pro A:199 -Pro A:200
2Pro B:199 -Pro B:200

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032796T152MACK1_HUMANPolymorphism56161912A/BT152M
2UniProtVAR_032797E346KACK1_HUMANUnclassified  ---A/BE346K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032796T152MACK1_HUMANPolymorphism56161912AT152M
2UniProtVAR_032797E346KACK1_HUMANUnclassified  ---AE346K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032796T152MACK1_HUMANPolymorphism56161912BT152M
2UniProtVAR_032797E346KACK1_HUMANUnclassified  ---BE346K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ACK1_HUMAN132-158
 
  2A:132-158
B:132-158
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ACK1_HUMAN248-260
 
  2A:248-260
B:248-260
3SH3PS50002 Src homology 3 (SH3) domain profile.ACK1_HUMAN373-448
 
  2A:373-390
B:373-388
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ACK1_HUMAN132-158
 
  1A:132-158
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ACK1_HUMAN248-260
 
  1A:248-260
-
3SH3PS50002 Src homology 3 (SH3) domain profile.ACK1_HUMAN373-448
 
  1A:373-390
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ACK1_HUMAN132-158
 
  1-
B:132-158
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ACK1_HUMAN248-260
 
  1-
B:248-260
3SH3PS50002 Src homology 3 (SH3) domain profile.ACK1_HUMAN373-448
 
  1-
B:373-388

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000003336022ENSE00001349875chr3:195635955-195635356600ACK1_HUMAN-00--
1.11aENST0000033360211aENSE00002160972chr3:195615477-195615297181ACK1_HUMAN1-55550--
1.12aENST0000033360212aENSE00001304480chr3:195613918-19561384871ACK1_HUMAN55-78240--
1.13eENST0000033360213eENSE00001329097chr3:195611904-195611683222ACK1_HUMAN79-152742A:115-152 (gaps)
B:117-152 (gaps)
38
36
1.13fENST0000033360213fENSE00001311022chr3:195610180-195610028153ACK1_HUMAN153-203512A:153-203 (gaps)
B:153-203 (gaps)
51
51
1.15bENST0000033360215bENSE00001607977chr3:195609199-195608922278ACK1_HUMAN204-296932A:204-296 (gaps)
B:204-296
93
93
1.16dENST0000033360216dENSE00001309827chr3:195606046-195605920127ACK1_HUMAN296-338432A:296-338
B:296-338
43
43
1.17bENST0000033360217bENSE00001293158chr3:195605463-195605317147ACK1_HUMAN339-387492A:339-387
B:339-387
49
49
1.18ENST0000033360218ENSE00001316210chr3:195605218-19560512495ACK1_HUMAN388-419322A:388-390
B:388-388
3
1
1.21cENST0000033360221cENSE00001299263chr3:195599341-195599147195ACK1_HUMAN419-484660--
1.22fENST0000033360222fENSE00001317846chr3:195597076-19559698592ACK1_HUMAN484-515320--
1.22rENST0000033360222rENSE00001300682chr3:195595580-1955942321349ACK1_HUMAN515-9644500--
1.23bENST0000033360223bENSE00001317558chr3:195594129-19559404090ACK1_HUMAN965-994300--
1.24ENST0000033360224ENSE00001301267chr3:195593887-195593760128ACK1_HUMAN995-1037430--
1.25bENST0000033360225bENSE00001770160chr3:195591058-195590235824ACK1_HUMAN1037-103820--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:263
 aligned with ACK1_HUMAN | Q07912 from UniProtKB/Swiss-Prot  Length:1038

    Alignment length:276
                                   124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384      
           ACK1_HUMAN   115 QSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP 390
               SCOP domains d1u54a_ A: Activated    CDC42 kinase 1, ACK1                                                                                                                                                                                                                                         SCOP domains
               CATH domains 1u54A01 A:115-207 Ph   osphorylase Kinase; dom         ain 1                                 1u54A02 A:208-390 Transferase(Phosphotransferase) domain 1                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee.hhh.eee......---..eeeeeee.....eeeeeeee.---------.hhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.......ee.....-.hhhhhhhhhhhhheehhhhhhhhhhhhhhhhh..........hhhhhhhhhh............hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------M-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K-------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------PROTEIN_KINASE_ATP         -----------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------SH3  PDB: A:373-39 PROSITE
           Transcript 1 (1) Exon 1.13e  PDB: A:115-152 (gaps)     Exon 1.13f  PDB: A:153-203 (gaps) UniProt: 153-203 Exon 1.15b  PDB: A:204-296 (gaps) UniProt: 204-296                                           ------------------------------------------Exon 1.17b  PDB: A:339-387 UniProt: 339-387      1.1 Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16d  PDB: A:296-338 UniProt: 296-338---------------------------------------------------- Transcript 1 (2)
                 1u54 A 115 QSLTCLIGEKDLRLLEKLGD---GVVRRGEWDAPSGKTVSVAVKCL---------AMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHyVMQEHR-VPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP 390
                                   124       134   |   144       154     |   -     | 174       184       194       204       214       224       234       244       254       264       274       284     | 294       304       314       324       334       344       354       364       374       384      
                                             134 138                   160       170                                                                                                               284-PTR90 |                                                                                                  
                                                                                                                                                                                                           292                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:261
 aligned with ACK1_HUMAN | Q07912 from UniProtKB/Swiss-Prot  Length:1038

    Alignment length:272
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386  
           ACK1_HUMAN   117 LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA 388
               SCOP domains d1u54b_ B: Activat   ed CDC42 kinase 1, ACK1                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1u54B01 B:117-207    Phosphorylase Kinase; d        omain 1                                1u54B02 B:208-388 Transferase(Phosphotransferase) domain 1                                                                                                                            CATH domains
           Pfam domains (1) ---------Pkinase_T   yr-1u54B01 B:126-385                                                                                                                                                                                                                                    --- Pfam domains (1)
           Pfam domains (2) ---------Pkinase_T   yr-1u54B02 B:126-385                                                                                                                                                                                                                                    --- Pfam domains (2)
         Sec.struct. author ..ee.....eeeeeeee.---..eeeeeee.....eeeeeeee.--------..hhhhhhhhhhhhhh.......eeeee.....eeeee....eehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhee....hhh.eee.....eee......ee.......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------------M-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------PROTEIN_KINASE_ATP         -----------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------SH3              PROSITE
           Transcript 1 (1) Exon 1.13e  PDB: B:117-152 (gaps)   Exon 1.13f  PDB: B:153-203 (gaps) UniProt: 153-203 Exon 1.15b  PDB: B:204-296 UniProt: 204-296                                                  ------------------------------------------Exon 1.17b  PDB: B:339-387 UniProt: 339-387      1 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16d  PDB: B:296-338 UniProt: 296-338-------------------------------------------------- Transcript 1 (2)
                 1u54 B 117 LTCLIGEKDLRLLEKLGD---GVVRRGEWDAPSGKTVSVAVKCL--------EAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA 388
                                   126       | - |     146       156   |     -  |    176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386  
                                           134 138                   160      169                                                                                                                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PKinase (934)

(-) Gene Ontology  (42, 42)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (ACK1_HUMAN | Q07912)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005095    GTPase inhibitor activity    Stops, prevents or reduces the activity of any enzyme that catalyzes the hydrolysis of GTP to GDP and orthophosphate.
    GO:0050699    WW domain binding    Interacting selectively and non-covalently with a WW domain of a protein, a small module composed of 40 amino acids and plays a role in mediating protein-protein interactions via proline-rich regions.
    GO:0005154    epidermal growth factor receptor binding    Interacting selectively and non-covalently with the epidermal growth factor receptor.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004715    non-membrane spanning protein tyrosine kinase activity    Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004712    protein serine/threonine/tyrosine kinase activity    Catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; ATP + a protein threonine = ADP + protein threonine phosphate; and ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0016477    cell migration    The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0034260    negative regulation of GTPase activity    Any process that stops or reduces the rate of GTP hydrolysis by a GTPase.
    GO:0038083    peptidyl-tyrosine autophosphorylation    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:2000369    regulation of clathrin-dependent endocytosis    Any process that modulates the frequency, rate or extent of clathrin-mediated endocytosis.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0070436    Grb2-EGFR complex    A protein complex that contains the epidermal growth factor receptor (EGFR) and Grb2, and is involved in linking EGFR activation to the p21-Ras pathway.
    GO:0005912    adherens junction    A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0030136    clathrin-coated vesicle    A vesicle with a coat formed of clathrin connected to the membrane via one of the clathrin adaptor complexes.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0030659    cytoplasmic vesicle membrane    The lipid bilayer surrounding a cytoplasmic vesicle.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0031234    extrinsic component of cytoplasmic side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PTR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:199 - Pro A:200   [ RasMol ]  
    Pro B:199 - Pro B:200   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1u54
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACK1_HUMAN | Q07912
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.112
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACK1_HUMAN | Q07912
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACK1_HUMAN | Q079121cf4 1u46 1u4d 3eqp 3eqr 4ewh 4hzr 4hzs 4id7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1U54)