Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  [HPP19-23]-PNPY BOUND TO DPC MICELLES
 
Authors :  M. Lerch, H. Kamimori, G. Folkers, M. I. Aguilar, A. G. Beck-Sickinger, O. Zerbe
Date :  09 Jul 04  (Deposition) - 05 Jul 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Npy-Pp Chimera, Neuropeptide (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Lerch, H. Kamimori, G. Folkers, M. I. Aguilar, A. G. Beck-Sickinger, O. Zerbe
Strongly Altered Receptor Binding Properties In Pp And Npy Chimeras Are Accompanied By Changes In Structure And Membrane Binding
Biochemistry V. 44 9255 2005
PubMed-ID: 15966750  |  Reference-DOI: 10.1021/BI0501232
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHIMERA OF NEUROPEPTIDE Y AND PANCREATIC HORMONE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPUBK19-[HPP19-23]-PNPY-G
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonPIG, HUMAN
    Organism ScientificSUS SCROFA, HOMO SAPIENS
    Organism Taxid9823,9606
    Strain,
    Synonym[HPP19-23]-PNPY

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:35 , TYR A:36BINDING SITE FOR RESIDUE NH2 A 37

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TZ4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TZ4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TZ4)

(-) PROSITE Motifs  (2, 3)

NMR Structure (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PANCREATIC_HORMONE_2PS50276 Pancreatic hormone family profile.NPY_PIG10-45  1A:1-36
PAHO_HUMAN30-65  1A:2-36
2PANCREATIC_HORMONE_1PS00265 Pancreatic hormone family signature.NPY_PIG29-45  1A:20-36
PAHO_HUMAN49-65  1A:20-36

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002259921ENSE00001473033chr17:42019833-4201978945PAHO_HUMAN-00--
1.2ENST000002259922ENSE00000854213chr17:42019022-42018832191PAHO_HUMAN1-64641A:1-3535
1.3ENST000002259923ENSE00000731194chr17:42018582-4201851172PAHO_HUMAN64-88251A:35-373
1.4ENST000002259924ENSE00001059480chr17:42018320-42018172149PAHO_HUMAN88-9580--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:37
 aligned with NPY_PIG | P01304 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:37
                                    19        29        39       
               NPY_PIG   10 YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYG 46
               SCOP domains d1tz4a1 A:1-36 Neuropeptide Y       - SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains Hormone_3-1tz4A02Hormone_3-1tz4A01  - Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                PROSITE (1) PANCREATIC_HORMONE_2  PDB: A:1-36   - PROSITE (1)
                PROSITE (2) -------------------PANCREATIC_HORMON- PROSITE (2)
                 Transcript ------------------------------------- Transcript
                  1tz4 A  1 YPSKPDNPGEDAPAEDLAQYAADLRHYINLITRQRYx 37
                                    10        20        30      |
                                                               37-NH2

Chain A from PDB  Type:PROTEIN  Length:37
 aligned with PAHO_HUMAN | P01298 from UniProtKB/Swiss-Prot  Length:95

    Alignment length:37
                                    39        49        59       
            PAHO_HUMAN   30 APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYG 66
               SCOP domains d1tz4a1 A:1-36 Neuropeptide Y       - SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains Hormone_3-1tz4A02Hormone_3-1tz4A01  - Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------- PROSITE (2)
                PROSITE (3) PANCREATIC_HORMONE_2  PDB: A:2-36   - PROSITE (3)
                PROSITE (1) -------------------PANCREATIC_HORMON- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: A:1-35 UniProt: 1-64-- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------1.3 Transcript 1 (2)
                  1tz4 A  1 YPSKPDNPGEDAPAEDLAQYAADLRHYINLITRQRYx 37
                                    10        20        30      |
                                                               37-NH2

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1TZ4)

(-) Pfam Domains  (2, 2)

NMR Structure

(-) Gene Ontology  (20, 29)

NMR Structure(hide GO term definitions)
Chain A   (NPY_PIG | P01304)
molecular function
    GO:0001664    G-protein coupled receptor binding    Interacting selectively and non-covalently with a G-protein coupled receptor.
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0005184    neuropeptide hormone activity    The action characteristic of a neuropeptide hormone, any peptide hormone that acts in the central nervous system. A neuropeptide is any of several types of molecules found in brain tissue, composed of short chains of amino acids; they include endorphins, enkephalins, vasopressin, and others. They are often localized in axon terminals at synapses and are classified as putative neurotransmitters, although some are also hormones.
biological process
    GO:0008343    adult feeding behavior    Feeding behavior in a fully developed and mature organism.
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0007631    feeding behavior    Behavior associated with the intake of food.
    GO:0090275    negative regulation of somatostatin secretion    Any process that decreases the rate, frequency, extent of the regulated release of somatostatin from secretory granules in the D cells of the pancreas.
    GO:0007218    neuropeptide signaling pathway    The series of molecular signals generated as a consequence of a peptide neurotransmitter binding to a cell surface receptor.
    GO:0032100    positive regulation of appetite    Any process that increases appetite.
    GO:0090274    positive regulation of somatostatin secretion    Any process that increases the rate, frequency, extent of the regulated release of somatostatin from secretory granules in the D cells of the pancreas.
    GO:0032098    regulation of appetite    Any process which modulates appetite, the desire or physical craving for food.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain A   (PAHO_HUMAN | P01298)
molecular function
    GO:0001664    G-protein coupled receptor binding    Interacting selectively and non-covalently with a G-protein coupled receptor.
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0005184    neuropeptide hormone activity    The action characteristic of a neuropeptide hormone, any peptide hormone that acts in the central nervous system. A neuropeptide is any of several types of molecules found in brain tissue, composed of short chains of amino acids; they include endorphins, enkephalins, vasopressin, and others. They are often localized in axon terminals at synapses and are classified as putative neurotransmitters, although some are also hormones.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0007631    feeding behavior    Behavior associated with the intake of food.
    GO:0007218    neuropeptide signaling pathway    The series of molecular signals generated as a consequence of a peptide neurotransmitter binding to a cell surface receptor.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0098779    positive regulation of macromitophagy in response to mitochondrial depolarization    The macromitophagy process that is triggered by a detection of the loss of mitochondrial membrane potential.
    GO:0009306    protein secretion    The controlled release of proteins from a cell.
    GO:0032098    regulation of appetite    Any process which modulates appetite, the desire or physical craving for food.
    GO:0098792    xenophagy    The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tz4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tz4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NPY_PIG | P01304
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PAHO_HUMAN | P01298
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NPY_PIG | P01304
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PAHO_HUMAN | P01298
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NPY_PIG | P013041f8p 1fvn 1icy 1tz5
        PAHO_HUMAN | P012981tz5

(-) Related Entries Specified in the PDB File

1f8p PNPY BOUND TO DPC MICELLES
1ljv BPP BOUND TO DPC MICELLES
1tz5 [PNPY19-23]-HPP BOUND TO DPC MICELLES