Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  HIP1R THATCH DOMAIN CORE
 
Authors :  T. J. Brett, D. H. Fremont, Midwest Center For Structural Genomics (Mcsg)
Date :  19 Sep 03  (Deposition) - 06 Jul 04  (Release) - 14 Jul 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,D,E,F,G,H,I
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  D  (1x)
Biol. Unit 4:  E  (1x)
Biol. Unit 5:  F  (1x)
Biol. Unit 6:  G  (1x)
Biol. Unit 7:  H  (1x)
Biol. Unit 8:  I  (1x)
Keywords :  Endocytosis, Actin-Binding, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. J. Brett, V. Legendre-Guillemin, P. S. Mcpherson, D. H. Fremont
Structural Definition Of The F-Actin-Binding Thatch Domain From Hip1R
Nat. Struct. Mol. Biol. V. 13 121 2006
PubMed-ID: 16415883  |  Reference-DOI: 10.1038/NSMB1043
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HUNTINGTIN INTERACTING PROTEIN 12
    ChainsA, B, D, E, F, G, H, I
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPGEX-4T1
    Expression System StrainBL21 DE3
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL THATCH DOMAIN, RESIDUES 771-971
    GeneHIP1R, HIP12, KIAA0655
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymHIP1-RELATED;
HIP 12

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABDEFGHI
Biological Unit 1 (1x)A       
Biological Unit 2 (1x) B      
Biological Unit 3 (1x)  D     
Biological Unit 4 (1x)   E    
Biological Unit 5 (1x)    F   
Biological Unit 6 (1x)     G  
Biological Unit 7 (1x)      H 
Biological Unit 8 (1x)       I

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 34)

Asymmetric Unit (1, 34)
No.NameCountTypeFull Name
1MSE34Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 5 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 6 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 7 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 8 (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1R0D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1R0D)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Ser A:929 -Pro A:930
2Ser B:929 -Pro B:930
3Ser D:929 -Pro D:930
4Ser E:929 -Pro E:930
5Ser F:929 -Pro F:930
6Ser G:929 -Pro G:930
7Ser H:929 -Pro H:930
8Ser I:929 -Pro I:930

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 16)

Asymmetric Unit (2, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051A/B/D/E/F/G/H/IV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414A/B/D/E/F/G/H/IN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051AV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414AN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051BV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414BN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051DV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414DN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051EV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414EN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051FV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414FN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051GV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414GN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051HV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414HN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020043V782MHIP1R_HUMANPolymorphism2271051IV782M
2UniProtVAR_051031N943SHIP1R_HUMANPolymorphism3736414IN943S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R0D)

(-) Exons   (8, 58)

Asymmetric Unit (8, 58)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000002530832ENSE00001507340chr12:123320039-123320190152HIP1R_HUMAN1-31310--
1.3ENST000002530833ENSE00000895181chr12:123332578-12333264164HIP1R_HUMAN32-53220--
1.4ENST000002530834ENSE00000895169chr12:123333013-123333155143HIP1R_HUMAN53-100480--
1.5ENST000002530835ENSE00000895174chr12:123333343-12333339957HIP1R_HUMAN101-119190--
1.6ENST000002530836ENSE00000895178chr12:123334422-12333450281HIP1R_HUMAN120-146270--
1.10bENST0000025308310bENSE00001188693chr12:123335382-12333545877HIP1R_HUMAN147-172260--
1.11ENST0000025308311ENSE00000895189chr12:123335783-12333584462HIP1R_HUMAN172-193220--
1.12ENST0000025308312ENSE00001188688chr12:123338590-123338730141HIP1R_HUMAN193-240480--
1.13ENST0000025308313ENSE00000895193chr12:123339452-12333950958HIP1R_HUMAN240-259200--
1.14ENST0000025308314ENSE00000895197chr12:123339600-12333967576HIP1R_HUMAN259-284260--
1.15ENST0000025308315ENSE00000895219chr12:123339812-123339952141HIP1R_HUMAN285-331470--
1.16ENST0000025308316ENSE00000895220chr12:123340098-12334015962HIP1R_HUMAN332-352210--
1.17ENST0000025308317ENSE00000895205chr12:123340378-12334045073HIP1R_HUMAN352-376250--
1.18ENST0000025308318ENSE00000895222chr12:123340527-123340710184HIP1R_HUMAN377-438620--
1.19ENST0000025308319ENSE00000895225chr12:123340803-12334089189HIP1R_HUMAN438-467300--
1.20ENST0000025308320ENSE00000895213chr12:123340979-123341095117HIP1R_HUMAN468-506390--
1.21ENST0000025308321ENSE00000895228chr12:123341172-123341273102HIP1R_HUMAN507-540340--
1.22aENST0000025308322aENSE00000895217chr12:123341568-123341762195HIP1R_HUMAN541-605650--
1.23ENST0000025308323ENSE00000895246chr12:123342649-123342796148HIP1R_HUMAN606-655500--
1.24ENST0000025308324ENSE00001188648chr12:123342896-12334298287HIP1R_HUMAN655-684300--
1.25ENST0000025308325ENSE00001188647chr12:123343385-123343492108HIP1R_HUMAN684-720370--
1.26ENST0000025308326ENSE00001121168chr12:123343608-123343744137HIP1R_HUMAN720-765460--
1.27ENST0000025308327ENSE00001188644chr12:123343973-123344083111HIP1R_HUMAN766-802378A:773-802
B:773-802
D:773-802
E:773-802
F:773-802
G:773-802
H:773-802
I:773-802
30
30
30
30
30
30
30
30
1.28ENST0000025308328ENSE00000895231chr12:123344319-12334437759HIP1R_HUMAN803-822208A:803-822
B:803-822
D:803-822
E:803-822
F:803-822
G:803-822
H:803-822
I:803-822
20
20
20
20
20
20
20
20
1.29ENST0000025308329ENSE00000895234chr12:123344594-12334462431HIP1R_HUMAN822-832118A:822-832
B:822-832
D:822-832
E:822-832
F:822-832
G:822-832
H:822-832
I:822-832
11
11
11
11
11
11
11
11
1.30ENST0000025308330ENSE00000895237chr12:123344695-12334475763HIP1R_HUMAN833-853218A:833-853
B:833-853
D:833-853
E:833-853
F:833-853
G:833-853
H:833-853
I:833-853
21
21
21
21
21
21
21
21
1.31ENST0000025308331ENSE00000895240chr12:123344970-123345070101HIP1R_HUMAN854-887348A:854-887
B:854-887
D:854-887
E:854-887
F:854-887
G:854-887
H:854-887
I:854-887
34
34
34
34
34
34
34
34
1.32ENST0000025308332ENSE00000895243chr12:123345226-123345331106HIP1R_HUMAN887-922368A:887-922
B:887-922
D:887-922
E:887-922
F:887-922
G:887-922
H:887-922
I:887-922
36
36
36
36
36
36
36
36
1.33ENST0000025308333ENSE00001188631chr12:123345463-123345586124HIP1R_HUMAN923-964428A:923-964
B:923-962
D:923-962
E:923-962
F:923-962
G:923-962
H:923-962
I:923-964
42
40
40
40
40
40
40
42
1.34ENST0000025308334ENSE00000895249chr12:123345678-12334573962HIP1R_HUMAN964-984212A:964-966
-
-
-
-
-
-
I:964-966
3
-
-
-
-
-
-
3
1.35ENST0000025308335ENSE00000895252chr12:123345855-123346061207HIP1R_HUMAN985-1053690--
1.36ENST0000025308336ENSE00001292069chr12:123346253-1233475071255HIP1R_HUMAN1054-1068150--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:194
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:194
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962    
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTM 966
               SCOP domains d1r0da_ A: Huntingtin interacting protein 12                                                                                                                                                       SCOP domains
               CATH domains 1r0dA00 A:773-965 I/LWEQ domain                                                                                                                                                                  - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: A:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: A:854-887         -----------------------------------Exon 1.33  PDB: A:923-964 UniProt: 923-964-- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: A:887-922           -----------------------------------------1.3 Transcript 1 (2)
                 1r0d A 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTm 966
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962   |
                                        787-MSE          804-MSE                    831-MSE                                                                                                                                966-MSE
                                                          805-MSE                                                                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0db_ B: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dB00 B:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: B:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: B:854-887         -----------------------------------Exon 1.33  PDB: B:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: B:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d B 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain D from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0dd_ D: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dD00 D:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: D:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: D:854-887         -----------------------------------Exon 1.33  PDB: D:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: D:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d D 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain E from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0de_ E: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dE00 E:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: E:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: E:854-887         -----------------------------------Exon 1.33  PDB: E:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: E:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d E 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain F from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0df_ F: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dF00 F:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: F:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: F:854-887         -----------------------------------Exon 1.33  PDB: F:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: F:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d F 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain G from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0dg_ G: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dG00 G:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: G:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: G:854-887         -----------------------------------Exon 1.33  PDB: G:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: G:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d G 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain H from PDB  Type:PROTEIN  Length:190
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:190
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
               SCOP domains d1r0dh_ H: Huntingtin interacting protein 12                                                                                                                                                   SCOP domains
               CATH domains 1r0dH00 H:773-962 I/LWEQ domain                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: H:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: H:854-887         -----------------------------------Exon 1.33  PDB: H:923-962 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: H:887-922           ---------------------------------------- Transcript 1 (2)
                 1r0d H 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIED 962
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962
                                        787-MSE          804-MSE                    831-MSE                                                                                                                               
                                                          805-MSE                                                                                                                                                         

Chain I from PDB  Type:PROTEIN  Length:194
 aligned with HIP1R_HUMAN | O75146 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:194
                                   782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962    
          HIP1R_HUMAN   773 DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTM 966
               SCOP domains d1r0di_ I: Huntingtin interacting protein 12                                                                                                                                                       SCOP domains
               CATH domains 1r0dI00 I:773-965 I/LWEQ domain                                                                                                                                                                  - CATH domains
           Pfam domains (1) ----------------------------------------------I_LWEQ-1r0dI01 I:819-966                                                                                                                             Pfam domains (1)
           Pfam domains (2) ----------------------------------------------I_LWEQ-1r0dI02 I:819-966                                                                                                                             Pfam domains (2)
           Pfam domains (3) ----------------------------------------------I_LWEQ-1r0dI03 I:819-966                                                                                                                             Pfam domains (3)
           Pfam domains (4) ----------------------------------------------I_LWEQ-1r0dI04 I:819-966                                                                                                                             Pfam domains (4)
           Pfam domains (5) ----------------------------------------------I_LWEQ-1r0dI05 I:819-966                                                                                                                             Pfam domains (5)
           Pfam domains (6) ----------------------------------------------I_LWEQ-1r0dI06 I:819-966                                                                                                                             Pfam domains (6)
           Pfam domains (7) ----------------------------------------------I_LWEQ-1r0dI07 I:819-966                                                                                                                             Pfam domains (7)
           Pfam domains (8) ----------------------------------------------I_LWEQ-1r0dI08 I:819-966                                                                                                                             Pfam domains (8)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------M----------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.27  PDB: I:773-802     Exon 1.28           ----------Exon 1.30            Exon 1.31  PDB: I:854-887         -----------------------------------Exon 1.33  PDB: I:923-964 UniProt: 923-964-- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.29  ------------------------------------------------------Exon 1.32  PDB: I:887-922           -----------------------------------------1.3 Transcript 1 (2)
                 1r0d I 773 DVRQEELGAVVDKEmAATSAAIEDAVRRIEDmmNQARHASSGVKLEVNERILNSCTDLmKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTm 966
                                   782    |  792       802 ||    812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962   |
                                        787-MSE          804-MSE                    831-MSE                                                                                                                                966-MSE
                                                          805-MSE                                                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit
1a1r0dB00B:773-962
1b1r0dD00D:773-962
1c1r0dE00E:773-962
1d1r0dF00F:773-962
1e1r0dG00G:773-962
1f1r0dH00H:773-962
1g1r0dA00A:773-965
1h1r0dI00I:773-965

(-) Pfam Domains  (1, 8)

Asymmetric Unit
1aI_LWEQ-1r0dI01I:819-966
1bI_LWEQ-1r0dI02I:819-966
1cI_LWEQ-1r0dI03I:819-966
1dI_LWEQ-1r0dI04I:819-966
1eI_LWEQ-1r0dI05I:819-966
1fI_LWEQ-1r0dI06I:819-966
1gI_LWEQ-1r0dI07I:819-966
1hI_LWEQ-1r0dI08I:819-966

(-) Gene Ontology  (19, 19)

Asymmetric Unit(hide GO term definitions)
Chain A,B,D,E,F,G,H,I   (HIP1R_HUMAN | O75146)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0030276    clathrin binding    Interacting selectively and non-covalently with a clathrin heavy or light chain, the main components of the coat of coated vesicles and coated pits, and which also occurs in synaptic vesicles.
    GO:0035091    phosphatidylinositol binding    Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0005543    phospholipid binding    Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0072583    clathrin-dependent endocytosis    An endocytosis process that begins when material is taken up into clathrin-coated pits, which then pinch off to form clathrin-coated endocytic vesicles.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
cellular component
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0030136    clathrin-coated vesicle    A vesicle with a coat formed of clathrin connected to the membrane via one of the clathrin adaptor complexes.
    GO:0030665    clathrin-coated vesicle membrane    The lipid bilayer surrounding a clathrin-coated vesicle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0012505    endomembrane system    A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1r0d)
 
  Cis Peptide Bonds
    Ser A:929 - Pro A:930   [ RasMol ]  
    Ser B:929 - Pro B:930   [ RasMol ]  
    Ser D:929 - Pro D:930   [ RasMol ]  
    Ser E:929 - Pro E:930   [ RasMol ]  
    Ser F:929 - Pro F:930   [ RasMol ]  
    Ser G:929 - Pro G:930   [ RasMol ]  
    Ser H:929 - Pro H:930   [ RasMol ]  
    Ser I:929 - Pro I:930   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r0d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HIP1R_HUMAN | O75146
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HIP1R_HUMAN | O75146
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R0D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R0D)