Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE AGONIST FORM OF GLUCOCORTICOID RECEPTOR
 
Authors :  B. Kauppi, C. Jakob, M. Farnegardh, J. Yang, H. Ahola, M. Alarcon, K. Calles, O. Engstrom, J. Harlan, S. Muchmore, A. -K. Ramqvist, S. Thorell, L. Ohman, J. Greer, J. -A. Gustafsson, J. Carlstedt-Duke, M. Carlquist
Date :  09 May 03  (Deposition) - 08 Jul 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,E  (1x)
Biol. Unit 2:  B,F  (1x)
Biol. Unit 3:  C,G  (1x)
Biol. Unit 4:  D,H  (1x)
Keywords :  Protien-Ligand Complex, Anti Parallel Alpha Helix Sandwich, Hormone Receptor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Kauppi, C. Jakob, M. Farnegardh, J. Yang, H. Ahola, M. Alarcon, K. Calles, O. Engstrom, J. Harlan, S. Muchmore, A. -K. Ramqvist, S. Thorell, L. Ohman, J. Greer, J. -A. Gustafsson, J. Carlstedt-Duke, M. Carlquist
The Three-Dimensional Structures Of Antagonistic And Agonistic Forms Of The Glucocorticoid Receptor Ligand-Binding Domain: Ru-486 Induces A Transconformation That Leads To Active Antagonism.
J. Biol. Chem. V. 278 22748 2003
PubMed-ID: 12686538  |  Reference-DOI: 10.1074/JBC.M212711200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUCOCORTICOID RECEPTOR
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentRESIDUE 500-777, HINGE AND STEROID BINDING DOMAINS
    GeneNR3C1 OR GRL
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGR
 
Molecule 2 - NUCLEAR RECEPTOR COACTIVATOR 2
    ChainsE, F, G, H
    EngineeredYES
    FragmentTIF PEPTIDE 12MER
    Other DetailsSYNTHETIZED PEPTIDE
    SynonymNCOA-2, TRANSCRIPTIONAL INTERMEDIARY FACTOR 2
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)A   E   
Biological Unit 2 (1x) B   F  
Biological Unit 3 (1x)  C   G 
Biological Unit 4 (1x)   D   H

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1DEX4Ligand/IonDEXAMETHASONE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1DEX1Ligand/IonDEXAMETHASONE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1DEX1Ligand/IonDEXAMETHASONE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1DEX1Ligand/IonDEXAMETHASONE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1DEX1Ligand/IonDEXAMETHASONE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREMET A:560 , LEU A:563 , ASN A:564 , GLY A:567 , GLN A:570 , MET A:601 , MET A:604 , ARG A:611 , PHE A:623 , GLN A:642 , MET A:646 , TYR A:735 , CYS A:736 , THR A:739 , ILE A:747BINDING SITE FOR RESIDUE DEX A 1999
2AC2SOFTWAREMET B:560 , ASN B:564 , GLY B:567 , GLN B:570 , MET B:601 , MET B:604 , ARG B:611 , PHE B:623 , GLN B:642 , MET B:646 , TYR B:735 , CYS B:736 , THR B:739BINDING SITE FOR RESIDUE DEX B 2999
3AC3SOFTWAREMET C:560 , LEU C:563 , ASN C:564 , GLY C:567 , GLN C:570 , MET C:601 , ARG C:611 , PHE C:623 , GLN C:642 , MET C:646 , LEU C:732 , TYR C:735 , CYS C:736 , THR C:739BINDING SITE FOR RESIDUE DEX C 3999
4AC4SOFTWAREMET D:560 , LEU D:563 , ASN D:564 , GLY D:567 , GLN D:570 , MET D:601 , MET D:604 , LEU D:608 , ARG D:611 , PHE D:623 , GLN D:642 , MET D:646 , TYR D:735 , CYS D:736 , THR D:739 , ILE D:747 , PHE D:749BINDING SITE FOR RESIDUE DEX D 4999

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1P93)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1P93)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (15, 60)

Asymmetric Unit (15, 60)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_075800T556IGCR_HUMANDisease (GCCR)  ---A/B/C/DT556I
02UniProtVAR_015632I559NGCR_HUMANDisease (GCCR)104893909A/B/C/DI559N
03UniProtVAR_025014V571AGCR_HUMANPolymorphism104893911A/B/C/DV571A
04UniProtVAR_075801V575GGCR_HUMANUnclassified (GCCR)  ---A/B/C/DV575G
05UniProtVAR_004676D641VGCR_HUMANDisease (GCCR)104893908A/B/C/DD641V
06UniProtVAR_077145L672PGCR_HUMANDisease (GCCR)  ---A/B/C/DL672P
07UniProtVAR_013473G679SGCR_HUMANDisease (GCCR)104893914A/B/C/DG679S
08UniProtVAR_075802R714QGCR_HUMANUnclassified (GCCR)  ---A/B/C/DR714Q
09UniProtVAR_075803H726RGCR_HUMANUnclassified (GCCR)  ---A/B/C/DH726R
10UniProtVAR_004677V729IGCR_HUMANDisease (GCCR)  ---A/B/C/DV729I
11UniProtVAR_071935F737LGCR_HUMANDisease (GCCR)121909727A/B/C/DF737L
12UniProtVAR_015633I747MGCR_HUMANDisease (GCCR)104893910A/B/C/DI747M
13UniProtVAR_004678L753FGCR_HUMANPolymorphism121909726A/B/C/DL753F
14UniProtVAR_075804N766SGCR_HUMANPolymorphism  ---A/B/C/DN766S
15UniProtVAR_071936L773PGCR_HUMANDisease (GCCR)104893912A/B/C/DL773P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_075800T556IGCR_HUMANDisease (GCCR)  ---AT556I
02UniProtVAR_015632I559NGCR_HUMANDisease (GCCR)104893909AI559N
03UniProtVAR_025014V571AGCR_HUMANPolymorphism104893911AV571A
04UniProtVAR_075801V575GGCR_HUMANUnclassified (GCCR)  ---AV575G
05UniProtVAR_004676D641VGCR_HUMANDisease (GCCR)104893908AD641V
06UniProtVAR_077145L672PGCR_HUMANDisease (GCCR)  ---AL672P
07UniProtVAR_013473G679SGCR_HUMANDisease (GCCR)104893914AG679S
08UniProtVAR_075802R714QGCR_HUMANUnclassified (GCCR)  ---AR714Q
09UniProtVAR_075803H726RGCR_HUMANUnclassified (GCCR)  ---AH726R
10UniProtVAR_004677V729IGCR_HUMANDisease (GCCR)  ---AV729I
11UniProtVAR_071935F737LGCR_HUMANDisease (GCCR)121909727AF737L
12UniProtVAR_015633I747MGCR_HUMANDisease (GCCR)104893910AI747M
13UniProtVAR_004678L753FGCR_HUMANPolymorphism121909726AL753F
14UniProtVAR_075804N766SGCR_HUMANPolymorphism  ---AN766S
15UniProtVAR_071936L773PGCR_HUMANDisease (GCCR)104893912AL773P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_075800T556IGCR_HUMANDisease (GCCR)  ---BT556I
02UniProtVAR_015632I559NGCR_HUMANDisease (GCCR)104893909BI559N
03UniProtVAR_025014V571AGCR_HUMANPolymorphism104893911BV571A
04UniProtVAR_075801V575GGCR_HUMANUnclassified (GCCR)  ---BV575G
05UniProtVAR_004676D641VGCR_HUMANDisease (GCCR)104893908BD641V
06UniProtVAR_077145L672PGCR_HUMANDisease (GCCR)  ---BL672P
07UniProtVAR_013473G679SGCR_HUMANDisease (GCCR)104893914BG679S
08UniProtVAR_075802R714QGCR_HUMANUnclassified (GCCR)  ---BR714Q
09UniProtVAR_075803H726RGCR_HUMANUnclassified (GCCR)  ---BH726R
10UniProtVAR_004677V729IGCR_HUMANDisease (GCCR)  ---BV729I
11UniProtVAR_071935F737LGCR_HUMANDisease (GCCR)121909727BF737L
12UniProtVAR_015633I747MGCR_HUMANDisease (GCCR)104893910BI747M
13UniProtVAR_004678L753FGCR_HUMANPolymorphism121909726BL753F
14UniProtVAR_075804N766SGCR_HUMANPolymorphism  ---BN766S
15UniProtVAR_071936L773PGCR_HUMANDisease (GCCR)104893912BL773P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_075800T556IGCR_HUMANDisease (GCCR)  ---CT556I
02UniProtVAR_015632I559NGCR_HUMANDisease (GCCR)104893909CI559N
03UniProtVAR_025014V571AGCR_HUMANPolymorphism104893911CV571A
04UniProtVAR_075801V575GGCR_HUMANUnclassified (GCCR)  ---CV575G
05UniProtVAR_004676D641VGCR_HUMANDisease (GCCR)104893908CD641V
06UniProtVAR_077145L672PGCR_HUMANDisease (GCCR)  ---CL672P
07UniProtVAR_013473G679SGCR_HUMANDisease (GCCR)104893914CG679S
08UniProtVAR_075802R714QGCR_HUMANUnclassified (GCCR)  ---CR714Q
09UniProtVAR_075803H726RGCR_HUMANUnclassified (GCCR)  ---CH726R
10UniProtVAR_004677V729IGCR_HUMANDisease (GCCR)  ---CV729I
11UniProtVAR_071935F737LGCR_HUMANDisease (GCCR)121909727CF737L
12UniProtVAR_015633I747MGCR_HUMANDisease (GCCR)104893910CI747M
13UniProtVAR_004678L753FGCR_HUMANPolymorphism121909726CL753F
14UniProtVAR_075804N766SGCR_HUMANPolymorphism  ---CN766S
15UniProtVAR_071936L773PGCR_HUMANDisease (GCCR)104893912CL773P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_075800T556IGCR_HUMANDisease (GCCR)  ---DT556I
02UniProtVAR_015632I559NGCR_HUMANDisease (GCCR)104893909DI559N
03UniProtVAR_025014V571AGCR_HUMANPolymorphism104893911DV571A
04UniProtVAR_075801V575GGCR_HUMANUnclassified (GCCR)  ---DV575G
05UniProtVAR_004676D641VGCR_HUMANDisease (GCCR)104893908DD641V
06UniProtVAR_077145L672PGCR_HUMANDisease (GCCR)  ---DL672P
07UniProtVAR_013473G679SGCR_HUMANDisease (GCCR)104893914DG679S
08UniProtVAR_075802R714QGCR_HUMANUnclassified (GCCR)  ---DR714Q
09UniProtVAR_075803H726RGCR_HUMANUnclassified (GCCR)  ---DH726R
10UniProtVAR_004677V729IGCR_HUMANDisease (GCCR)  ---DV729I
11UniProtVAR_071935F737LGCR_HUMANDisease (GCCR)121909727DF737L
12UniProtVAR_015633I747MGCR_HUMANDisease (GCCR)104893910DI747M
13UniProtVAR_004678L753FGCR_HUMANPolymorphism121909726DL753F
14UniProtVAR_075804N766SGCR_HUMANPolymorphism  ---DN766S
15UniProtVAR_071936L773PGCR_HUMANDisease (GCCR)104893912DL773P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1P93)

(-) Exons   (5, 20)

Asymmetric Unit (5, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.9aENST000003944649aENSE00001816085chr5:142783265-142782776490GCR_HUMAN-00--
1.12cENST0000039446412cENSE00001171430chr5:142780417-1427792211197GCR_HUMAN1-3953950--
1.14aENST0000039446414aENSE00001039522chr5:142693733-142693567167GCR_HUMAN395-451570--
1.15ENST0000039446415ENSE00000910346chr5:142689778-142689662117GCR_HUMAN451-490400--
1.16bENST0000039446416bENSE00001082914chr5:142680328-142680050279GCR_HUMAN490-583944A:527-583
B:529-583
C:527-583
D:527-583
57
55
57
57
1.17ENST0000039446417ENSE00001082913chr5:142678377-142678233145GCR_HUMAN583-631494A:583-631
B:583-631
C:583-631
D:583-631
49
49
49
49
1.18ENST0000039446418ENSE00001082912chr5:142675155-142675025131GCR_HUMAN631-675454A:631-675
B:631-675
C:631-675
D:631-675
45
45
45
45
1.20ENST0000039446420ENSE00001082911chr5:142662290-142662133158GCR_HUMAN675-727534A:675-727 (gaps)
B:675-727 (gaps)
C:675-727 (gaps)
D:675-727 (gaps)
53
53
53
53
1.21eENST0000039446421eENSE00001171419chr5:142661606-1426574964111GCR_HUMAN728-777504A:728-776
B:728-776
C:728-776
D:728-776
49
49
49
49

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:247
 aligned with GCR_HUMAN | P04150 from UniProtKB/Swiss-Prot  Length:777

    Alignment length:250
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776
            GCR_HUMAN   527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
               SCOP domains d1p93a_ A: Glucocorticoid receptor                                                                                                                                                                                                                         SCOP domains
               CATH domains 1p93A00 A:527-776 Retinoid X Receptor                                                                                                                                                                                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......ee.....ee.........hhhhhhhhhhhhhhhh....hhhhhhhhhhhh...ee......hhhhhhhhhhhhhhhhhhhhhh.---..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....ee..... Sec.struct. author
                 SAPs(SNPs) -----------------------------I--N-----------A---G-----------------------------------------------------------------V------------------------------P------S----------------------------------Q-----------R--I-------L---------M-----F------------S------P--- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16b  PDB: A:527-583 UniProt: 490-583 [INCOMPLETE] -----------------------------------------------Exon 1.18  PDB: A:631-675 UniProt: 631-675   ----------------------------------------------------Exon 1.21e  PDB: A:728-776 UniProt: 728-777       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.17  PDB: A:583-631 UniProt: 583-631       -------------------------------------------Exon 1.20  PDB: A:675-727 (gaps) UniProt: 675-727    ------------------------------------------------- Transcript 1 (2)
                 1p93 A 527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       | - |     716       726       736       746       756       766       776
                                                                                                                                                                                                           704 708                                                                    

Chain B from PDB  Type:PROTEIN  Length:245
 aligned with GCR_HUMAN | P04150 from UniProtKB/Swiss-Prot  Length:777

    Alignment length:248
                                   538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758       768        
            GCR_HUMAN   529 TPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
               SCOP domains d1p93b_ B: Glucocorticoid receptor                                                                                                                                                                                                                       SCOP domains
               CATH domains 1p93B00 B:529-776 Retinoid X Receptor                                                                                                                                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eee.........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhh.---...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------I--N-----------A---G-----------------------------------------------------------------V------------------------------P------S----------------------------------Q-----------R--I-------L---------M-----F------------S------P--- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16b  PDB: B:529-583 UniProt: 490-583            -----------------------------------------------Exon 1.18  PDB: B:631-675 UniProt: 631-675   ----------------------------------------------------Exon 1.21e  PDB: B:728-776 UniProt: 728-777       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.17  PDB: B:583-631 UniProt: 583-631       -------------------------------------------Exon 1.20  PDB: B:675-727 (gaps) UniProt: 675-727    ------------------------------------------------- Transcript 1 (2)
                 1p93 B 529 TPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
                                   538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698     | 708       718       728       738       748       758       768        
                                                                                                                                                                                                         704 708                                                                    

Chain C from PDB  Type:PROTEIN  Length:247
 aligned with GCR_HUMAN | P04150 from UniProtKB/Swiss-Prot  Length:777

    Alignment length:250
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776
            GCR_HUMAN   527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
               SCOP domains d1p93c_ C: Glucocorticoid receptor                                                                                                                                                                                                                         SCOP domains
               CATH domains 1p93C00 C:527-776 Retinoid X Receptor                                                                                                                                                                                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......ee.....ee.........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...ee......hhhhhhhhhhhhhhhhhhhhhh.---..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh....ee..... Sec.struct. author
                 SAPs(SNPs) -----------------------------I--N-----------A---G-----------------------------------------------------------------V------------------------------P------S----------------------------------Q-----------R--I-------L---------M-----F------------S------P--- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16b  PDB: C:527-583 UniProt: 490-583 [INCOMPLETE] -----------------------------------------------Exon 1.18  PDB: C:631-675 UniProt: 631-675   ----------------------------------------------------Exon 1.21e  PDB: C:728-776 UniProt: 728-777       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.17  PDB: C:583-631 UniProt: 583-631       -------------------------------------------Exon 1.20  PDB: C:675-727 (gaps) UniProt: 675-727    ------------------------------------------------- Transcript 1 (2)
                 1p93 C 527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       | - |     716       726       736       746       756       766       776
                                                                                                                                                                                                           704 708                                                                    

Chain D from PDB  Type:PROTEIN  Length:247
 aligned with GCR_HUMAN | P04150 from UniProtKB/Swiss-Prot  Length:777

    Alignment length:250
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776
            GCR_HUMAN   527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
               SCOP domains d1p93d_ D: Glucocorticoid receptor                                                                                                                                                                                                                         SCOP domains
               CATH domains 1p93D00 D:527-776 Retinoid X Receptor                                                                                                                                                                                                                      CATH domains
           Pfam domains (1) ---------------Hormone_recep-1p93D01 D:542-753                                                                                                                                                                                     ----------------------- Pfam domains (1)
           Pfam domains (2) ---------------Hormone_recep-1p93D02 D:542-753                                                                                                                                                                                     ----------------------- Pfam domains (2)
           Pfam domains (3) ---------------Hormone_recep-1p93D03 D:542-753                                                                                                                                                                                     ----------------------- Pfam domains (3)
           Pfam domains (4) ---------------Hormone_recep-1p93D04 D:542-753                                                                                                                                                                                     ----------------------- Pfam domains (4)
         Sec.struct. author .....hhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee..eee.........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..ee......hhhhhhhhhhhhhhhhhhhhhh.---..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....ee..... Sec.struct. author
                 SAPs(SNPs) -----------------------------I--N-----------A---G-----------------------------------------------------------------V------------------------------P------S----------------------------------Q-----------R--I-------L---------M-----F------------S------P--- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16b  PDB: D:527-583 UniProt: 490-583 [INCOMPLETE] -----------------------------------------------Exon 1.18  PDB: D:631-675 UniProt: 631-675   ----------------------------------------------------Exon 1.21e  PDB: D:728-776 UniProt: 728-777       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.17  PDB: D:583-631 UniProt: 583-631       -------------------------------------------Exon 1.20  PDB: D:675-727 (gaps) UniProt: 675-727    ------------------------------------------------- Transcript 1 (2)
                 1p93 D 527 QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ 776
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       | - |     716       726       736       746       756       766       776
                                                                                                                                                                                                           704 708                                                                    

Chain E from PDB  Type:PROTEIN  Length:9
 aligned with NCOA2_HUMAN | Q15596 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:9
          NCOA2_HUMAN   743 ALLRYLLDK 751
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1p93 E 942 ALLRYLLDK 950

Chain F from PDB  Type:PROTEIN  Length:9
 aligned with NCOA2_HUMAN | Q15596 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:9
          NCOA2_HUMAN   743 ALLRYLLDK 751
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1p93 F 942 ALLRYLLDK 950

Chain G from PDB  Type:PROTEIN  Length:9
 aligned with NCOA2_HUMAN | Q15596 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:9
          NCOA2_HUMAN   743 ALLRYLLDK 751
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1p93 G 942 ALLRYLLDK 950

Chain H from PDB  Type:PROTEIN  Length:9
 aligned with NCOA2_HUMAN | Q15596 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:9
          NCOA2_HUMAN   743 ALLRYLLDK 751
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1p93 H 942 ALLRYLLDK 950

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (83, 91)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (GCR_HUMAN | P04150)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0004883    glucocorticoid receptor activity    Combining with a glucocorticoid and transmitting the signal within the cell trigger a change in cell activity or function.
    GO:0038051    glucocorticoid-activated RNA polymerase II transcription factor binding transcription factor activity    Combining with a glucocorticoid and transmitting the signal to the transcriptional machinery by interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to modulate transcription. For example, glucocorticoid-bound receptors can bind to transcription factor complexes to regulate transcription of genes whose promoters do not contain glucocorticoid response elements.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
    GO:1990239    steroid hormone binding    Interacting selectively and non-covalently with a steroid hormone.
    GO:0003707    steroid hormone receptor activity    Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0001077    transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0071383    cellular response to steroid hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
    GO:0007059    chromosome segregation    The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets. In eukaryotes, chromosome segregation begins with the condensation of chromosomes, includes chromosome separation, and ends when chromosomes have completed movement to the spindle poles.
    GO:0043402    glucocorticoid mediated signaling pathway    A series of molecular signals mediated by the detection of a glucocorticoid hormone.
    GO:0042921    glucocorticoid receptor signaling pathway    Any series of molecular signals generated as a consequence of a glucocorticoid binding to its receptor.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0043401    steroid hormone mediated signaling pathway    A series of molecular signals mediated by a steroid hormone binding to a receptor.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Chain E,F,G,H   (NCOA2_HUMAN | Q15596)
molecular function
    GO:0070182    DNA polymerase binding    Interacting selectively and non-covalently with a DNA polymerase.
    GO:0030165    PDZ domain binding    Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0001162    RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding    Interacting selectively and non-covalently with an RNA polymerase II intronic DNA sequence that regulates the transcription of the transcript it is contained within.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0030331    estrogen receptor binding    Interacting selectively and non-covalently with an estrogen receptor.
    GO:0035259    glucocorticoid receptor binding    Interacting selectively and non-covalently with a glucocorticoid receptor.
    GO:0004402    histone acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
    GO:0016922    ligand-dependent nuclear receptor binding    Interacting selectively and non-covalently, in a ligand dependent manner, with a nuclear receptor protein.
    GO:0030374    ligand-dependent nuclear receptor transcription coactivator activity    The function of a transcription cofactor that activates transcription in conjuction with a ligand-dependent nuclear receptor from a RNA polymerase II promoter; does not bind DNA itself.
    GO:0035257    nuclear hormone receptor binding    Interacting selectively and non-covalently with a nuclear hormone receptor, a ligand-dependent receptor found in the nucleus of the cell.
    GO:0033142    progesterone receptor binding    Interacting selectively and non-covalently with a progesterone receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0042974    retinoic acid receptor binding    Interacting selectively and non-covalently with the retinoic acid receptor, a ligand-regulated transcription factor belonging to the nuclear receptor superfamily.
    GO:0046965    retinoid X receptor binding    Interacting selectively and non-covalently with a retinoid X receptor.
    GO:0046966    thyroid hormone receptor binding    Interacting selectively and non-covalently with a thyroid hormone receptor.
    GO:0030375    thyroid hormone receptor coactivator activity    The function of a transcription cofactor that activates transcription in conjunction with a thyroid hormone-dependent nuclear receptor from a RNA polymerase II promoter; does not bind DNA itself.
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
    GO:0015721    bile acid and bile salt transport    The directed movement of bile acid and bile salts into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0044255    cellular lipid metabolic process    The chemical reactions and pathways involving lipids, as carried out by individual cells.
    GO:1904017    cellular response to Thyroglobulin triiodothyronine    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a Thyroglobulin triiodothyronine stimulus.
    GO:0032870    cellular response to hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
    GO:0021549    cerebellum development    The process whose specific outcome is the progression of the cerebellum over time, from its formation to the mature structure. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. In mice, the cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
    GO:0032922    circadian regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression such that an expression pattern recurs with a regularity of approximately 24 hours.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0016573    histone acetylation    The modification of a histone by the addition of an acetyl group.
    GO:0030522    intracellular receptor signaling pathway    Any series of molecular signals initiated by a ligand binding to an receptor located within a cell.
    GO:0045475    locomotor rhythm    The rhythm of the locomotor activity of an organism during its 24 hour activity cycle.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0045925    positive regulation of female receptivity    Any process that activates or increases the receptiveness of a female to male advances.
    GO:2000324    positive regulation of glucocorticoid receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of glucocorticoid receptor signaling pathway.
    GO:2000273    positive regulation of receptor activity    Any process that activates or increases the frequency, rate or extent of receptor activity.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0010906    regulation of glucose metabolic process    Any process that modulates the rate, frequency or extent of glucose metabolism. Glucose metabolic processes are the chemical reactions and pathways involving glucose, the aldohexose gluco-hexose.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0043197    dendritic spine    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0014069    postsynaptic density of dendrite    An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.
    GO:0048786    presynaptic active zone    A specialized region of the plasma membrane and cell cortex of a presynaptic neuron; encompasses a region of the plasma membrane where synaptic vesicles dock and fuse, and a specialized cortical cytoskeletal matrix.
    GO:0005791    rough endoplasmic reticulum    The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DEX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1p93)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1p93
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GCR_HUMAN | P04150
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  NCOA2_HUMAN | Q15596
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  615962
    Disease InformationOMIM
 
Access by GenAge ID
  0075
    Age Related InformationGenAge
  0212
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GCR_HUMAN | P04150
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NCOA2_HUMAN | Q15596
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GCR_HUMAN | P041501m2z 1nhz 3bqd 3cld 3e7c 3h52 3k22 3k23 4csj 4hn5 4hn6 4lsj 4mdd 4p6w 4p6x 4udc 4udd 5cbx 5cby 5cbz 5cc1 5e69 5e6a 5e6b 5e6c 5e6d 5emc 5emp 5emq 5g3j 5g5w
        NCOA2_HUMAN | Q155961gwq 1gwr 1m2z 1mv9 1mvc 1mzn 1t63 1t65 1uhl 1yok 1zdt 1zdu 1zky 2ao6 2b1v 2b1z 2b23 2fai 2g44 2g5o 2ldc 2p15 2p1t 2p1u 2p1v 2q7j 2q7l 2yjd 2zxz 2zy0 3a9e 3cld 3dzu 3dzy 3e00 3e7c 3e94 3erd 3fug 3gn8 3k22 3k23 3kwy 3kyt 3l0e 3l0j 3l0l 3o1d 3o1e 3oap 3ozj 3pcu 3plz 3q95 3q97 3r5m 3up0 3up3 4csj 4dos 4e2j 4fhh 4fhi 4ia1 4ia2 4ia3 4ia7 4iqr 4iu7 4iui 4iv2 4iv4 4ivw 4ivy 4iw6 4iw8 4iwc 4iwf 4k4j 4k6i 4m8e 4m8h 4nie 4nqa 4oc7 4p6w 4p6x 4pld 4ple 4poh 4poj 4pp3 4pp5 4pp6 4ppp 4pps 4pxm 4q0a 4qe6 4qe8 4rfw 4rmc 4rmd 4rme 4ruo 4udc 4udd 4wg0 4zn7 4zn9 4znh 4zns 4znt 4znu 4znv 4znw 4zo1 4zsh 5aph 5apj 5di7 5did 5die 5dig 5dk9 5dkb 5dke 5dkg 5dks 5dl4 5dlr 5dmc 5dmf 5dp0 5drj 5drm 5dtv 5du5 5due 5dug 5duh 5dvs 5dvv 5dwe 5dwg 5dwi 5dwj 5dx3 5dxb 5dxe 5dxg 5dxk 5dxm 5dxp 5dxq 5dxr 5dy8 5dyb 5dyd 5dz0 5dz1 5dz3 5dzh 5dzi 5e0w 5e0x 5e14 5e15 5e19 5e1c 5ec9 5egv 5ehj 5ei1 5eit 5g3j 5g42 5g43 5g44 5g45 5g46 5g5w 5h1e 5hyr 5i4v 5iaw 5ick 5kcc 5kcd 5kce 5kcf 5kct 5kcu 5kcw 5kd9 5kr9 5kra 5krc 5krf 5krh 5kri 5krj 5krk 5krl 5krm 5kro 5l11 5lga 5syz 5tld 5tlf 5tlg 5tll 5tlm 5tlo 5tlp 5tlt 5tlu 5tlv 5tlx 5tly 5tm1 5tm2 5tm3 5tm4 5tm5 5tm6 5tm7 5tm8 5tm9 5tml 5tmm 5tmo 5tmq 5tmr 5tms 5tmt 5tmu 5tmv 5tmw 5tmz 5tn1 5tn3 5tn4 5tn5 5tn6 5tn7 5tn8 5u2d

(-) Related Entries Specified in the PDB File

1nhz