|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1ORY) |
(no "Cis Peptide Bond" information available for 1ORY) |
(no "SAP(SNP)/Variant" information available for 1ORY) |
(no "PROSITE Motif" information available for 1ORY) |
(no "Exon" information available for 1ORY) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:119 aligned with O67806_AQUAE | O67806 from UniProtKB/TrEMBL Length:124 Alignment length:119 15 25 35 45 55 65 75 85 95 105 115 O67806_AQUAE 6 EAYFQNMVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKV 124 SCOP domains d1orya_ A: Flagellar export chaperone FliS SCOP domains CATH domains 1oryA00 A:1006-1124 [code=1.20.120.340, no name defined] CATH domains Pfam domains FliS-1oryA01 A:1006-1124 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1ory A 1006 EAYFQNQVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKV 1124 1015 1025 1035 1045 1055 1065 1075 1085 1095 1105 1115 Chain B from PDB Type:PROTEIN Length:40 aligned with FLAA_AQUAE | O67803 from UniProtKB/Swiss-Prot Length:518 Alignment length:40 488 498 508 518 FLAA_AQUAE 479 NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR 518 SCOP domains ---------------------------------------- SCOP domains CATH domains ---------------------------------------- CATH domains Pfam domains Flagellin_C-1oryB01 B:2479-2517 - Pfam domains SAPs(SNPs) ---------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------- PROSITE Transcript ---------------------------------------- Transcript 1ory B 2479 NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR 2518 2488 2498 2508 2518
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (O67806_AQUAE | O67806)
Chain B (FLAA_AQUAE | O67803)
|
|
|
|
|
|
|