1MFX - JenaLib

Theoretical Model (Jmol Viewer)

Title :   STRUCTURE OF CYTOCHROME P450 27A1

Authors :   D. Murtazina, A. V. Puchkaev, C. H. Schein, N. Oezguen, W. Braun, A. Nanavati, I. A. Pikuleva

Date :   13 Aug 02 (Deposition) - 09 Oct 02 (Release) - 09 Oct 02 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A,_^#
( ^#: chains that contain no standard or modified protein/DNA/RNA residue)

Keywords :   Mitochondrion, Heme, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Murtazina, A. V. Puchkaev, C. H. Schein, N. Oezguen, W. Braun, A. Nanavati, I. A. Pikuleva
Membrane-Protein Interactions Contribute To Efficient 27-Hydroxylation Of Cholesterol By Mitochondrial Cytochrome P450 27A1.
J. Biol. Chem. V. 277 37582 2002
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CYTOCHROME P450 27
	Chains	:	A
	EC Number	:	1.14.-.-
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	CYTOCHROME P-450C27/25, STEROL 26-HYDROXYLASE, STEROL 27-HYDROXYLASE, VITAMIN D(3) 25-HYDROXYLASE, 5-BETA- CHOLESTANE-3-ALPHA,7-ALPHA,12-ALPHA-TRIOL 27-HYDROXYLASE


Theoretical Model	:

( ^#: chains that contain no standard or modified protein/DNA/RNA residue)

Summary Information (see also Sequences/Alignments below)

Theoretical Model (1, 1)

No.	Name	Count	Type	Full Name
1	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

(no "Site" information available for 1MFX)

(no "SS Bond" information available for 1MFX)

Theoretical Model

No.	Residues
1	Val A:169	-	Ser A:170

Theoretical Model (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016966	G	145	E	CP27A_HUMAN	Disease (CTX)	72551313	A	G	112	E
2	UniProt	VAR_061046	A	169	V	CP27A_HUMAN	Polymorphism	59443548	A	A	136	V
3	UniProt	VAR_048467	T	175	M	CP27A_HUMAN	Polymorphism	2229381	A	T	142	M
4	UniProt	VAR_001303	R	395	C	CP27A_HUMAN	Disease (CTX)	121908096	A	R	362	C
5	UniProt	VAR_012285	R	395	S	CP27A_HUMAN	Disease (CTX)	121908096	A	R	362	S
6	UniProt	VAR_012286	R	405	Q	CP27A_HUMAN	Disease (CTX)	121908099	A	R	372	Q
7	UniProt	VAR_012287	R	474	Q	CP27A_HUMAN	Disease (CTX)	121908097	A	R	441	Q
8	UniProt	VAR_012288	R	474	W	CP27A_HUMAN	Disease (CTX)	121908098	A	R	441	W
9	UniProt	VAR_001304	R	479	C	CP27A_HUMAN	Disease (CTX)	72551322	A	R	446	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP27A_HUMAN	469-478	1	A:436-445

Theoretical Model (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000258415	1b	ENSE00001902442	chr2:219646479-219647160	682	CP27A_HUMAN	1-85	85	1	A:1-52	52
1.3	ENST00000258415	3	ENSE00001720227	chr2:219674300-219674490	191	CP27A_HUMAN	86-149	64	1	A:53-116	64
1.4a	ENST00000258415	4a	ENSE00001797288	chr2:219676945-219677144	200	CP27A_HUMAN	149-216	68	1	A:116-183	68
1.4c	ENST00000258415	4c	ENSE00001762923	chr2:219677275-219677472	198	CP27A_HUMAN	216-282	67	1	A:183-249	67
1.4e	ENST00000258415	4e	ENSE00001623918	chr2:219677647-219677819	173	CP27A_HUMAN	282-339	58	1	A:249-306	58
1.5c	ENST00000258415	5c	ENSE00000785876	chr2:219678744-219678910	167	CP27A_HUMAN	340-395	56	1	A:307-362	56
1.5e	ENST00000258415	5e	ENSE00000785877	chr2:219679103-219679181	79	CP27A_HUMAN	395-421	27	1	A:362-388	27
1.5f	ENST00000258415	5f	ENSE00000785878	chr2:219679268-219679480	213	CP27A_HUMAN	422-492	71	1	A:389-459	71
1.6b	ENST00000258415	6b	ENSE00001838541	chr2:219679634-219680016	383	CP27A_HUMAN	493-531	39	1	A:460-498	39

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:498
 aligned with CP27A_HUMAN | Q02318 from UniProtKB/Swiss-Prot  Length:531

    Alignment length:498
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523        
          CP27A_HUMAN    34 ALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC 531
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................................hhhhhhh.........hhhhhhhhhhh....ee.hhhhhee...hhhhhh..............hhhhhhhhhhhh.........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh......ee.....ee...ee.....ee..hhhhhh.hhhhhh.....hhhhh.............hhhhh..........hhhhhhhhhhhhhhhhhhhh.................................. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------------------------------------------------------------------E-----------------------V-----M---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C---------Q--------------------------------------------------------------------Q----C---------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------W--------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME----------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: A:1-52 UniProt: 1-85 [INCOMPLETE]   Exon 1.3  PDB: A:53-116 UniProt: 86-149                         ------------------------------------------------------------------Exon 1.4c  PDB: A:183-249 UniProt: 216-282                         ---------------------------------------------------------Exon 1.5c  PDB: A:307-362 UniProt: 340-395              --------------------------Exon 1.5f  PDB: A:389-459 UniProt: 422-492                             Exon 1.6b  PDB: A:460-498               Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: A:116-183 UniProt: 149-216                          -----------------------------------------------------------------Exon 1.4e  PDB: A:249-306 UniProt: 282-339                -------------------------------------------------------Exon 1.5e  PDB: A:362-388  -------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1mfx A   1 ALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC 498
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1MFX)

(no "CATH Domain" information available for 1MFX)

(no "Pfam Domain" information available for 1MFX)

Theoretical Model(hide GO term definitions)

Chain A (CP27A_HUMAN | Q02318)

molecular function
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
	GO:0008395	steroid hydroxylase activity	Catalysis of the formation of a hydroxyl group on a steroid by incorporation of oxygen from O2.
biological process
	GO:0006699	bile acid biosynthetic process	The chemical reactions and pathways resulting in the formation of bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0016125	sterol metabolic process	The chemical reactions and pathways involving sterols, steroids with one or more hydroxyl groups and a hydrocarbon side-chain in the molecule.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1mfx)

	Cis Peptide Bonds
		Val A:169 - Ser A:170	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1mfx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CP27A_HUMAN \| Q02318
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.14.-.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	213700
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CP27A_HUMAN \| Q02318
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1MFX)

(no "Related Entries Specified in the PDB File" available for 1MFX)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 9)

PROSITE Motifs (1, 1)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File