|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1J9I) |
(no "Site" information available for 1J9I) |
(no "SS Bond" information available for 1J9I) |
(no "Cis Peptide Bond" information available for 1J9I) |
(no "SAP(SNP)/Variant" information available for 1J9I) |
(no "PROSITE Motif" information available for 1J9I) |
(no "Exon" information available for 1J9I) |
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with TERS_LAMBD | P03707 from UniProtKB/Swiss-Prot Length:181 Alignment length:68 10 20 30 40 50 60 TERS_LAMBD 1 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE 68 SCOP domains d1j9ia_ A: Terminase gpNU1 subunit domain SCOP domains CATH domains 1j9iA00 A:1-68 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 1j9i A 1 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE 68 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:68 aligned with TERS_LAMBD | P03707 from UniProtKB/Swiss-Prot Length:181 Alignment length:68 10 20 30 40 50 60 TERS_LAMBD 1 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE 68 SCOP domains d1j9ib_ B: Terminase gpNU1 subunit domain SCOP domains CATH domains 1j9iB00 B:1-68 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 1j9i B 1 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE 68 10 20 30 40 50 60
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 1J9I) |
NMR Structure(hide GO term definitions) Chain A,B (TERS_LAMBD | P03707)
|
|
|
|
|
|
|