Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE VON WILLEBRAND FACTOR MUTANT (I546V) A1 DOMAIN
 
Authors :  K. Fukuda, T. A. Doggett, L. A. Bankston, M. A. Cruz, T. G. Diacovo, R. C. Liddington
Date :  25 Apr 01  (Deposition) - 10 Jul 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Dinucleotide-Binding Fold, Blood Clotting (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Fukuda, T. A. Doggett, L. A. Bankston, M. A. Cruz, T. G. Diacovo, R. C. Liddington
Structural Basis Of Von Willebrand Factor Activation By The Snake Toxin Botrocetin.
Structure V. 10 943 2002
PubMed-ID: 12121649  |  Reference-DOI: 10.1016/S0969-2126(02)00787-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VON WILLEBRAND FACTOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentA1 DOMAIN
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IJB)

(-) Sites  (0, 0)

(no "Site" information available for 1IJB)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:509 -A:695

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1IJB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (18, 18)

Asymmetric/Biological Unit (18, 18)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_005791P1266LVWF_HUMANDisease (VWD2)61749370AP503L
02UniProtVAR_005792H1268DVWF_HUMANDisease (VWD2)61749371AH505D
03UniProtVAR_067340C1272FVWF_HUMANDisease (VWD2)63524161AC509F
04UniProtVAR_005793C1272RVWF_HUMANDisease (VWD2)61749372AC509R
05UniProtVAR_005794R1306WVWF_HUMANDisease (VWD2)61749384AR543W
06UniProtVAR_005795R1308CVWF_HUMANDisease (VWD2)61749387AR545C
07UniProtVAR_005796W1313CVWF_HUMANDisease (VWD2)61749392AW550C
08UniProtVAR_005797V1314LVWF_HUMANDisease (VWD2)61749393AV551L
09UniProtVAR_005798V1316MVWF_HUMANDisease (VWD2)61749397AV553M
10UniProtVAR_005799V1318LVWF_HUMANDisease (VWD2)  ---AV555L
11UniProtVAR_005800G1324SVWF_HUMANDisease (VWD2)61749398AG561S
12UniProtVAR_005801R1341QVWF_HUMANDisease (VWD2)61749403AR578Q
13UniProtVAR_005802R1374CVWF_HUMANDisease (VWD2)61750071AR611C
14UniProtVAR_005803R1374HVWF_HUMANDisease (VWD2)61750072AR611H
15UniProtVAR_005804T1381AVWF_HUMANPolymorphism216311AA618A
16UniProtVAR_005805R1399HVWF_HUMANPolymorphism216312AR636H
17UniProtVAR_005806L1460VVWF_HUMANDisease (VWD2)61750088AL697V
18UniProtVAR_005807A1461VVWF_HUMANDisease (VWD2)61750089AA698V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1VWFAPS50234 VWFA domain profile.VWF_HUMAN1498-1665
1277-1453
1691-1871
  1-
A:514-690
-

(-) Exons   (1, 1)

Asymmetric/Biological Unit (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002614051ENSE00001184496chr12:6233836-6233587250VWF_HUMAN-00--
1.2ENST000002614052ENSE00001653826chr12:6232362-623230855VWF_HUMAN1-19190--
1.4ENST000002614054ENSE00001261893chr12:6230504-6230340165VWF_HUMAN19-74560--
1.5ENST000002614055ENSE00001261546chr12:6220134-6220032103VWF_HUMAN74-108350--
1.6ENST000002614056ENSE00002152539chr12:6219748-6219540209VWF_HUMAN108-178710--
1.7aENST000002614057aENSE00001676171chr12:6204750-6204626125VWF_HUMAN178-219420--
1.8ENST000002614058ENSE00001682720chr12:6184717-6184501217VWF_HUMAN220-292730--
1.9ENST000002614059ENSE00001640051chr12:6182907-6182785123VWF_HUMAN292-333420--
1.10ENST0000026140510ENSE00001656280chr12:6181608-6181497112VWF_HUMAN333-370380--
1.11ENST0000026140511ENSE00001700039chr12:6180509-618046347VWF_HUMAN370-386170--
1.12ENST0000026140512ENSE00001674584chr12:6174439-6174303137VWF_HUMAN386-431460--
1.13ENST0000026140513ENSE00001645253chr12:6173550-6173412139VWF_HUMAN432-478470--
1.14ENST0000026140514ENSE00001679915chr12:6172220-6172120101VWF_HUMAN478-511340--
1.15ENST0000026140515ENSE00001640163chr12:6167210-6167015196VWF_HUMAN512-577660--
1.16ENST0000026140516ENSE00001727074chr12:6166238-6166023216VWF_HUMAN577-649730--
1.17bENST0000026140517bENSE00000936967chr12:6161949-6161709241VWF_HUMAN649-729810--
1.18ENST0000026140518ENSE00000936968chr12:6155983-615588995VWF_HUMAN729-761330--
1.19ENST0000026140519ENSE00000936969chr12:6153617-6153457161VWF_HUMAN761-814540--
1.20ENST0000026140520ENSE00000936970chr12:6145657-6145554104VWF_HUMAN815-849350--
1.21ENST0000026140521ENSE00000936971chr12:6143992-6143854139VWF_HUMAN849-895470--
1.22ENST0000026140522ENSE00000936972chr12:6140744-6140610135VWF_HUMAN896-940450--
1.23ENST0000026140523ENSE00000936973chr12:6138654-6138508147VWF_HUMAN941-989490--
1.24ENST0000026140524ENSE00000936974chr12:6135212-6135072141VWF_HUMAN990-1036470--
1.25ENST0000026140525ENSE00001731504chr12:6134859-6134746114VWF_HUMAN1037-1074380--
1.26ENST0000026140526ENSE00000936976chr12:6132953-6132797157VWF_HUMAN1075-1127530--
1.27ENST0000026140527ENSE00001792722chr12:6132064-6131906159VWF_HUMAN1127-1180540--
1.28ENST0000026140528ENSE00001679248chr12:6131201-6131066136VWF_HUMAN1180-1225460--
1.29ENST0000026140529ENSE00001749068chr12:6128909-61275311379VWF_HUMAN1225-16854611A:500-701202
1.30ENST0000026140530ENSE00001676963chr12:6126036-6125920117VWF_HUMAN1685-1724400--
1.31ENST0000026140531ENSE00001646337chr12:6125822-6125682141VWF_HUMAN1724-1771480--
1.32ENST0000026140532ENSE00001603271chr12:6125398-6125255144VWF_HUMAN1771-1819490--
1.33ENST0000026140533ENSE00000936983chr12:6122811-6122647165VWF_HUMAN1819-1874560--
1.34ENST0000026140534ENSE00001761241chr12:6121296-612125344VWF_HUMAN1874-1888150--
1.35ENST0000026140535ENSE00001622286chr12:6120960-6120783178VWF_HUMAN1889-1948600--
1.36ENST0000026140536ENSE00001261636chr12:6105388-6105168221VWF_HUMAN1948-2021740--
1.37ENST0000026140537ENSE00000866874chr12:6103773-6103581193VWF_HUMAN2022-2086650--
1.38ENST0000026140538ENSE00000866873chr12:6103369-6103028342VWF_HUMAN2086-22001150--
1.39ENST0000026140539ENSE00001328745chr12:6101184-6100985200VWF_HUMAN2200-2266670--
1.40ENST0000026140540ENSE00001261609chr12:6094831-6094729103VWF_HUMAN2267-2301350--
1.41ENST0000026140541ENSE00001261603chr12:6094285-609421175VWF_HUMAN2301-2326260--
1.42ENST0000026140542ENSE00000866869chr12:6092420-6092316105VWF_HUMAN2326-2361360--
1.43ENST0000026140543ENSE00001309185chr12:6091157-6090952206VWF_HUMAN2361-2429690--
1.44ENST0000026140544ENSE00000866867chr12:6085426-6085277150VWF_HUMAN2430-2479500--
1.45ENST0000026140545ENSE00001261579chr12:6080875-6080765111VWF_HUMAN2480-2516370--
1.46ENST0000026140546ENSE00001316394chr12:6078557-6078377181VWF_HUMAN2517-2577610--
1.47ENST0000026140547ENSE00000866864chr12:6077333-607729341VWF_HUMAN2577-2590140--
1.48ENST0000026140548ENSE00001289624chr12:6076768-6076652117VWF_HUMAN2591-2629390--
1.49ENST0000026140549ENSE00001312819chr12:6062760-606266299VWF_HUMAN2630-2662330--
1.50ENST0000026140550ENSE00001326641chr12:6061685-6061557129VWF_HUMAN2663-2705430--
1.51ENST0000026140551ENSE00001307387chr12:6061049-606101040VWF_HUMAN2706-2719140--
1.52aENST0000026140552aENSE00001293437chr12:6059049-605895298VWF_HUMAN2719-2751330--
1.53bENST0000026140553bENSE00001314535chr12:6058369-6058040330VWF_HUMAN2752-2813620--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:202
 aligned with VWF_HUMAN | P04275 from UniProtKB/Swiss-Prot  Length:2813

    Alignment length:202
                                  1272      1282      1292      1302      1312      1322      1332      1342      1352      1362      1372      1382      1392      1402      1412      1422      1432      1442      1452      1462  
           VWF_HUMAN   1263 SEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEA 1464
               SCOP domains d1ijba_ A: von Willebrand factor A1 domain, vWA1                                                                                                                                                           SCOP domains
               CATH domains 1ijbA00 A:500-701  [code=3.40.50.410, no name defined]                                                                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeeeee.....hhhhhhhhhhhhhhhhhh.......eeeeeeee...eeeee......hhhhhhhhhhh.........hhhhhhhhhhhhh.........eeeeeeee....hhhhh.hhhhhhhhhhhh.eeeeeeee....hhhhhhhhhhhh.....eee.hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ---L-D---F---------------------------------W-C----CL-M-L-----S----------------Q--------------------------------C------A-----------------H------------------------------------------------------------VV--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------R-----------------------------------------------------------------------------------------------------H------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE --------------VWFA  PDB: A:514-690 UniProt: 1277-1453                                                                                                                                          ----------- PROSITE
               Transcript 1 Exon 1.29  PDB: A:500-701 UniProt: 1225-1685 [INCOMPLETE]                                                                                                                                                  Transcript 1
                1ijb A  500 SEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEA  701
                                   509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IJB)

(-) Gene Ontology  (28, 28)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (VWF_HUMAN | P04275)
molecular function
    GO:0051087    chaperone binding    Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0019865    immunoglobulin binding    Interacting selectively and non-covalently with an immunoglobulin.
    GO:0005178    integrin binding    Interacting selectively and non-covalently with an integrin.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007597    blood coagulation, intrinsic pathway    A protein activation cascade that contributes to blood coagulation and consists of the interactions among high molecular weight kininogen, prekallikrein, and factor XII that lead to the activation of clotting factor X.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0031589    cell-substrate adhesion    The attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0051260    protein homooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0035902    response to immobilization stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
cellular component
    GO:0033093    Weibel-Palade body    A large, elongated, rod-shaped secretory granule characteristic of vascular endothelial cells that contain a number of structurally and functionally distinct proteins, of which the best characterized are von Willebrand factor (VWF) and P-selectin. Weibel-Palade bodies are formed from the trans-Golgi network in a process that depends on VWF, which is densely packed in a highly organized manner, and on coat proteins that remain associated with the granules. Upon cell stimulation, regulated exocytosis releases the contained proteins to the cell surface, where they act in the recruitment of platelets and leukocytes and in inflammatory and vasoactive responses.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0031091    platelet alpha granule    A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ijb)
 
  Sites
(no "Sites" information available for 1ijb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ijb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ijb
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VWF_HUMAN | P04275
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  613554
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VWF_HUMAN | P04275
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        VWF_HUMAN | P042751ao3 1atz 1auq 1fe8 1fns 1ijk 1m10 1oak 1sq0 1u0n 1uex 2adf 2mhp 2mhq 3gxb 3hxo 3hxq 3ppv 3ppw 3ppx 3ppy 3zqk 4c29 4c2a 4c2b 4dmu 4nt5 5bv8

(-) Related Entries Specified in the PDB File

1auq 1AUQ IS THE WILD TYPE A1 DOMAIN
1ijk CRYSTAL STRUCTURE OF THE BIMOLECULAR COMPLEX OF THE VON WILLEBRAND FACTOR A1 DOMAIN-BOTROCETIN