Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  AML1/CBF-BETA/DNA COMPLEX
 
Authors :  J. Bravo, A. J. Warren
Date :  07 Mar 01  (Deposition) - 31 Mar 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,E,F  (1x)
Biol. Unit 2:  C,D,G,H  (1x)
Keywords :  Transcription Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Bravo, Z. Li, N. A. Speck, A. J. Warren
The Leukemia-Associated Aml1 (Runx1)-Cbfbeta Complex Functions As A Dna-Induced Molecular Clamp
Nat. Struct. Biol. V. 8 371 2001
PubMed-ID: 11276260  |  Reference-DOI: 10.1038/86264

(-) Compounds

Molecule 1 - CORE-BINDING FACTOR ALPHA SUBUNIT1
    ChainsA, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSET
    Expression System StrainDE3
    Expression System Taxid562
    Expression System VariantC41
    Expression System Vector TypePLASMID
    FragmentRUNT DOMAIN RESIDUES 50-183
    GeneAML1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCBFA2/PEPBP2AB/RUNX1, AML-1
 
Molecule 2 - CORE-BINDING FACTOR CBF-BETA
    ChainsB, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSET
    Expression System StrainDE3
    Expression System Taxid562
    Expression System VariantC41
    Expression System Vector TypePLASMID
    FragmentHETERODIMERISATION DOMAIN RESIDUES 2-135
    GeneCBFB
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - DNA (5'-(*GP*TP*TP*GP*CP*GP*GP*TP*TP*G)-3')
    ChainsE, G
    SyntheticYES
 
Molecule 4 - DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3')
    ChainsF, H
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)AB  EF  
Biological Unit 2 (1x)  CD  GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1H9D)

(-) Sites  (0, 0)

(no "Site" information available for 1H9D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1H9D)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Asn A:155 -Pro A:156
2Asn C:155 -Pro C:156

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_036226P100APEBB_HUMANUnclassified  ---B/DP100A
2CancerSNPVAR_PEBB_HUMAN_CCDS10827_1_01 *P100APEBB_HUMANDisease (Breast cancer)  ---B/DP100A
3UniProtVAR_012128R139QRUNX1_HUMANDisease (FPDMM)  ---A/CR139Q
4UniProtVAR_012129R174QRUNX1_HUMANDisease (FPDMM)74315450A/CR174Q
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_036226P100APEBB_HUMANUnclassified  ---BP100A
2CancerSNPVAR_PEBB_HUMAN_CCDS10827_1_01 *P100APEBB_HUMANDisease (Breast cancer)  ---BP100A
3UniProtVAR_012128R139QRUNX1_HUMANDisease (FPDMM)  ---AR139Q
4UniProtVAR_012129R174QRUNX1_HUMANDisease (FPDMM)74315450AR174Q
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_036226P100APEBB_HUMANUnclassified  ---DP100A
2CancerSNPVAR_PEBB_HUMAN_CCDS10827_1_01 *P100APEBB_HUMANDisease (Breast cancer)  ---DP100A
3UniProtVAR_012128R139QRUNX1_HUMANDisease (FPDMM)  ---CR139Q
4UniProtVAR_012129R174QRUNX1_HUMANDisease (FPDMM)74315450CR174Q
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1H9D)

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002908581ENSE00001297396chr16:67063050-67063388339PEBB_HUMAN1-26262B:2-26
D:2-26
25
25
1.2ENST000002908582ENSE00000688453chr16:67063630-6706371687PEBB_HUMAN27-55292B:27-55
D:27-55
29
29
1.3ENST000002908583ENSE00000688463chr16:67070542-67070658117PEBB_HUMAN56-94392B:56-94 (gaps)
D:56-94 (gaps)
39
39
1.4ENST000002908584ENSE00001046833chr16:67100585-67100701117PEBB_HUMAN95-133392B:95-133
D:95-133
39
39
1.5bENST000002908585bENSE00001301640chr16:67116116-67116242127PEBB_HUMAN134-176432B:134-135
D:134-135
2
2
1.6bENST000002908586bENSE00001597074chr16:67132613-671349612349PEBB_HUMAN176-18270--

2.18aENST0000034469118aENSE00001380483chr21:36260987-362591401848RUNX1_HUMAN1-90902A:54-90
C:54-90
37
37
2.19cENST0000034469119cENSE00001660291chr21:36253010-36252854157RUNX1_HUMAN91-143532A:91-143
C:91-143
53
53
2.20aENST0000034469120aENSE00002199204chr21:36231875-36231771105RUNX1_HUMAN143-178362A:143-178
C:143-178
36
36
2.22aENST0000034469122aENSE00002198909chr21:36206898-36206707192RUNX1_HUMAN178-242652A:178-178
C:178-178
1
1
2.25ENST0000034469125ENSE00002149931chr21:36171759-36171598162RUNX1_HUMAN242-296550--
2.26eENST0000034469126eENSE00001623427chr21:36164907-361600984810RUNX1_HUMAN296-4531580--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:125
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:125
                                    63        73        83        93       103       113       123       133       143       153       163       173     
          RUNX1_HUMAN    54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
               SCOP domains d1h9da_ A: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                               SCOP domains
               CATH domains 1h9dA00 A:54-178  [code=2.60.40.720, no name defined]                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee.....eeee....eee.........eeee........eeeeeee........ee..eeeee..eee....ee.........eeeeeee.....eeeeeeeeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------Q----------------------------------Q---- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: A:54-90 [INCOMPLETE]Exon 2.19c  PDB: A:91-143 UniProt: 91-143            ----------------------------------2 Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------------------------------------------Exon 2.20a  PDB: A:143-178           Transcript 2 (2)
                 1h9d A  54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
                                    63        73        83        93       103       113       123       133       143       153       163       173     

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1h9db_ B: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1h9dB00 B:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh....................---------..............eeeeeeeeee........................hhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:2-26    Exon 1.2  PDB: B:27-55       Exon 1.3  PDB: B:56-94 (gaps)          Exon 1.4  PDB: B:95-133 UniProt: 95-1331. Transcript 1
                 1h9d B   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP---------TPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        |-        81        91       101       111       121       131    
                                                                                               70        80                                                       

Chain C from PDB  Type:PROTEIN  Length:125
 aligned with RUNX1_HUMAN | Q01196 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:125
                                    63        73        83        93       103       113       123       133       143       153       163       173     
          RUNX1_HUMAN    54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
               SCOP domains d1h9dc_ C: Acute myeloid leukemia 1 protein (AML1), RUNT domain                                                               SCOP domains
               CATH domains 1h9dC00 C:54-178  [code=2.60.40.720, no name defined]                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee.....eeee....eee.........eeee........eeeeeee........ee..eeeee..eee....ee.........eeeeeee.....eeeeeeeeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------Q----------------------------------Q---- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.18a  PDB: C:54-90 [INCOMPLETE]Exon 2.19c  PDB: C:91-143 UniProt: 91-143            ----------------------------------2 Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------------------------------------------Exon 2.20a  PDB: C:143-178           Transcript 2 (2)
                 1h9d C  54 VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR 178
                                    63        73        83        93       103       113       123       133       143       153       163       173     

Chain D from PDB  Type:PROTEIN  Length:129
 aligned with PEBB_HUMAN | Q13951 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
           PEBB_HUMAN     2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
               SCOP domains d1h9dd_ D: Core binding factor beta, CBF                                                                                               SCOP domains
               CATH domains 1h9dD00 D:2-135  [code=2.40.250.10, no name defined]                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhh........................-----..............eeeeeeeeee........................hhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------A----------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: D:2-26    Exon 1.2  PDB: D:27-55       Exon 1.3  PDB: D:56-94 (gaps)          Exon 1.4  PDB: D:95-133 UniProt: 95-1331. Transcript 1
                 1h9d D   2 PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQ-----TPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135
                                    11        21        31        41        51        61        71  |     81        91       101       111       121       131    
                                                                                                   74    80                                                       

Chain E from PDB  Type:DNA  Length:10
                                          
                 1h9d E   1 GTTGCGGTTG  10
                                    10

Chain F from PDB  Type:DNA  Length:10
                                          
                 1h9d F   1 CAACCGCAAC  10
                                    10

Chain G from PDB  Type:DNA  Length:10
                                          
                 1h9d G   1 GTTGCGGTTG  10
                                    10

Chain H from PDB  Type:DNA  Length:10
                                          
                 1h9d H   1 CAACCGCAAC  10
                                    10

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1H9D)

(-) Gene Ontology  (38, 46)

Asymmetric Unit(hide GO term definitions)
Chain A,C   (RUNX1_HUMAN | Q01196)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000977    RNA polymerase II regulatory region sequence-specific DNA binding    Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0001047    core promoter binding    Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0000975    regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates a DNA-based process. Such processes include transcription, DNA replication, and DNA repair.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0001228    transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in the transcription regulatory region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
biological process
    GO:0002062    chondrocyte differentiation    The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
    GO:0071425    hematopoietic stem cell proliferation    The expansion of a hematopoietic stem cell population by cell division. A hematopoietic stem cell is a stem cell from which all cells of the lymphoid and myeloid lineages develop.
    GO:0030097    hemopoiesis    The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
    GO:0030099    myeloid cell differentiation    The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
    GO:0030853    negative regulation of granulocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of granulocyte differentiation.
    GO:0001503    ossification    The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
    GO:0048935    peripheral nervous system neuron development    The process whose specific outcome is the progression of a neuron whose cell body is located in the peripheral nervous system, from initial commitment of the cell to a neuronal fate, to the fully functional differentiated neuron.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0030854    positive regulation of granulocyte differentiation    Any process that activates or increases the frequency, rate or extent of granulocyte differentiation.
    GO:0032743    positive regulation of interleukin-2 production    Any process that activates or increases the frequency, rate, or extent of interleukin-2 production.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D   (PEBB_HUMAN | Q13951)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0048469    cell maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
    GO:0060216    definitive hemopoiesis    A second wave of blood cell production that, in vertebrates, generates long-term hemopoietic stem cells that continously provide erythroid, myeloid and lymphoid lineages throughout adulthood.
    GO:0030098    lymphocyte differentiation    The process in which a relatively unspecialized precursor cell acquires specialized features of a lymphocyte. A lymphocyte is a leukocyte commonly found in the blood and lymph that has the characteristics of a large nucleus, a neutral staining cytoplasm, and prominent heterochromatin.
    GO:0030099    myeloid cell differentiation    The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
    GO:0001503    ossification    The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
    GO:0001649    osteoblast differentiation    The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1h9d)
 
  Sites
(no "Sites" information available for 1h9d)
 
  Cis Peptide Bonds
    Asn A:155 - Pro A:156   [ RasMol ]  
    Asn C:155 - Pro C:156   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1h9d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PEBB_HUMAN | Q13951
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RUNX1_HUMAN | Q01196
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  601399
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PEBB_HUMAN | Q13951
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RUNX1_HUMAN | Q01196
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PEBB_HUMAN | Q139511cl3 1e50 4n9f
        RUNX1_HUMAN | Q011961cmo 1co1 1e50 1ljm

(-) Related Entries Specified in the PDB File

1cl3 MOLECULAR INSIGHTS INTO PEBP2/CBF-SMMHC ASSOCIATED ACUTE LEUKEMIA REVEALED FROM THE THREE-DIMENSIONAL STRUCTURE OF PEBP2/CBF BETA
1cmo IMMUNOGLOBULIN MOTIF DEOXYRIBONUCLEIC ACID- RECOGNITION AND HETERODIMERIZATION FOR THE PEBP2/CBF RUNT-DOMAIN
1co1 FOLD OF THE CBFA
1e50 AML1/CBF-BETA COMPLEX