Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  HUMAN BETA-DEFENSIN 2
 
Authors :  D. M. Hoover, J. Lubkowski
Date :  19 Jul 00  (Deposition) - 01 Nov 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Biol. Unit 5:  I,J  (1x)
Biol. Unit 6:  K,L  (1x)
Biol. Unit 7:  M,N  (1x)
Biol. Unit 8:  O,P  (1x)
Keywords :  Defensin, Human Beta-Defensin 2, Beta-Defensin, Antimicrobial Peptide (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. M. Hoover, K. R. Rajashankar, R. Blumenthal, A. Puri, J. J. Oppenheim, O. Chertov, J. Lubkowski
The Structure Of Human Beta-Defensin-2 Shows Evidence Of Higher Order Oligomerization.
J. Biol. Chem. V. 275 32911 2000
PubMed-ID: 10906336  |  Reference-DOI: 10.1074/JBC.M006098200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BETA-DEFENSIN 2
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
    EngineeredYES
    Other DetailsTHIS PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THIS PEPTIDE OCCURS NATURALLY IN HUMANS (HOMO SAPIENS)
    SynonymHBD-2, SKIN-ANTIMICROBIAL PEPTIDE 1
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMNOP
Biological Unit 1 (1x)AB              
Biological Unit 2 (1x)  CD            
Biological Unit 3 (1x)    EF          
Biological Unit 4 (1x)      GH        
Biological Unit 5 (1x)        IJ      
Biological Unit 6 (1x)          KL    
Biological Unit 7 (1x)            MN  
Biological Unit 8 (1x)              OP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric Unit (1, 5)
No.NameCountTypeFull Name
1SO45Ligand/IonSULFATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1SO4-1Ligand/IonSULFATE ION
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION
Biological Unit 4 (0, 0)
No.NameCountTypeFull Name
1SO4-1Ligand/IonSULFATE ION
Biological Unit 5 (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION
Biological Unit 6 (0, 0)
No.NameCountTypeFull Name
1SO4-1Ligand/IonSULFATE ION
Biological Unit 7 (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION
Biological Unit 8 (0, 0)
No.NameCountTypeFull Name
1SO4-1Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG I:22 , SO4 I:810 , HOH I:846 , HOH I:859 , TYR M:24 , LYS M:40 , HOH M:844 , HOH N:88BINDING SITE FOR RESIDUE SO4 M 807
2AC2SOFTWAREARG E:23 , ARG F:23 , TYR F:24 , LYS F:40 , HOH F:828 , HOH F:843 , HOH F:854BINDING SITE FOR RESIDUE SO4 F 808
3AC3SOFTWAREARG I:22 , HOH I:821 , HOH I:829 , HOH I:831 , HOH I:859 , PRO N:21 , ARG N:22 , ARG N:23BINDING SITE FOR RESIDUE SO4 I 809
4AC4SOFTWAREARG I:22 , HOH I:830 , HOH I:864 , LYS M:40 , SO4 M:807 , HOH M:829 , HOH M:833BINDING SITE FOR RESIDUE SO4 I 810
5AC5SOFTWARECYS A:20 , LYS A:25 , GLN A:26BINDING SITE FOR RESIDUE SO4 A 811

(-) SS Bonds  (48, 48)

Asymmetric Unit
No.Residues
1A:8 -A:37
2A:15 -A:30
3A:20 -A:38
4B:8 -B:37
5B:15 -B:30
6B:20 -B:38
7C:8 -C:37
8C:15 -C:30
9C:20 -C:38
10D:8 -D:37
11D:15 -D:30
12D:20 -D:38
13E:8 -E:37
14E:15 -E:30
15E:20 -E:38
16F:8 -F:37
17F:15 -F:30
18F:20 -F:38
19G:8 -G:37
20G:15 -G:30
21G:20 -G:38
22H:8 -H:37
23H:15 -H:30
24H:20 -H:38
25I:8 -I:37
26I:15 -I:30
27I:20 -I:38
28J:8 -J:37
29J:15 -J:30
30J:20 -J:38
31K:8 -K:37
32K:15 -K:30
33K:20 -K:38
34L:8 -L:37
35L:15 -L:30
36L:20 -L:38
37M:8 -M:37
38M:15 -M:30
39M:20 -M:38
40N:8 -N:37
41N:15 -N:30
42N:20 -N:38
43O:8 -O:37
44O:15 -O:30
45O:20 -O:38
46P:8 -P:37
47P:15 -P:30
48P:20 -P:38

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FD4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FD4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1FD4)

(-) Exons   (1, 16)

Asymmetric Unit (1, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003181571ENSE00001753483chr8:7274385-727429294DFB4A_HUMAN1-20200--
1.2ENST000003181572ENSE00001646530chr8:7272619-7272382238DFB4A_HUMAN20-644516A:1-41
B:1-41
C:1-41
D:1-41
E:1-41
F:1-41
G:1-41
H:1-41
I:1-41
J:1-41
K:1-41
L:1-41
M:1-41
N:1-41
O:1-41
P:1-41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4a_ A: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4A00 A:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eeee.......eeeee.....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: A:1-41 UniProt: 20-64      Transcript 1
                  1fd4 A  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain B from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4b_ B: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4B00 B:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: B:1-41 UniProt: 20-64      Transcript 1
                  1fd4 B  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain C from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4c_ C: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4C00 C:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: C:1-41 UniProt: 20-64      Transcript 1
                  1fd4 C  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain D from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4d_ D: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4D00 D:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: D:1-41 UniProt: 20-64      Transcript 1
                  1fd4 D  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain E from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4e_ E: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4E00 E:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: E:1-41 UniProt: 20-64      Transcript 1
                  1fd4 E  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain F from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4f_ F: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4F00 F:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: F:1-41 UniProt: 20-64      Transcript 1
                  1fd4 F  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain G from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4g_ G: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4G00 G:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: G:1-41 UniProt: 20-64      Transcript 1
                  1fd4 G  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain H from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4h_ H: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4H00 H:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: H:1-41 UniProt: 20-64      Transcript 1
                  1fd4 H  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain I from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4i_ I: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4I00 I:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: I:1-41 UniProt: 20-64      Transcript 1
                  1fd4 I  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain J from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4j_ J: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4J00 J:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: J:1-41 UniProt: 20-64      Transcript 1
                  1fd4 J  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain K from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4k_ K: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4K00 K:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: K:1-41 UniProt: 20-64      Transcript 1
                  1fd4 K  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain L from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4l_ L: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4L00 L:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: L:1-41 UniProt: 20-64      Transcript 1
                  1fd4 L  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain M from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4m_ M: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4M00 M:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eeee.......eeeee.....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: M:1-41 UniProt: 20-64      Transcript 1
                  1fd4 M  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain N from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4n_ N: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4N00 N:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh..eee........eeeee......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: N:1-41 UniProt: 20-64      Transcript 1
                  1fd4 N  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain O from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4o_ O: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4O00 O:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: O:1-41 UniProt: 20-64      Transcript 1
                  1fd4 O  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

Chain P from PDB  Type:PROTEIN  Length:41
 aligned with DFB4A_HUMAN | O15263 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:41
                                    33        43        53        63 
           DFB4A_HUMAN   24 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 64
               SCOP domains d1fd4p_ P: Beta-defensin, BD              SCOP domains
               CATH domains 1fd4P00 P:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..eee........eeee.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: P:1-41 UniProt: 20-64      Transcript 1
                  1fd4 P  1 GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 41
                                    10        20        30        40 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 16)

Asymmetric Unit

(-) CATH Domains  (1, 16)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FD4)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P   (DFB4A_HUMAN | O15263)
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0006935    chemotaxis    The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
cellular component
    GO:0005796    Golgi lumen    The volume enclosed by the membranes of any cisterna or subcompartment of the Golgi apparatus, including the cis- and trans-Golgi networks.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fd4)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fd4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DFB4A_HUMAN | O15263
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DFB4A_HUMAN | O15263
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DFB4A_HUMAN | O152631e4q 1fd3 1fqq

(-) Related Entries Specified in the PDB File

1fd3 HUMAN BETA-DEFENSIN 2, ORTHORHOMBIC