|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1EV0) |
(no "Site" information available for 1EV0) |
(no "SS Bond" information available for 1EV0) |
(no "Cis Peptide Bond" information available for 1EV0) |
(no "SAP(SNP)/Variant" information available for 1EV0) |
(no "PROSITE Motif" information available for 1EV0) |
(no "Exon" information available for 1EV0) |
NMR StructureChain A from PDB Type:PROTEIN Length:58 aligned with MINE_ECOLI | P0A734 from UniProtKB/Swiss-Prot Length:88 Alignment length:58 40 50 60 70 80 MINE_ECOLI 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88 SCOP domains d1ev0a_ A: SCOP domains CATH domains 1ev0A00 A:31-88 Cell Cycle Chain A CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 1ev0 A 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:58 aligned with MINE_ECOLI | P0A734 from UniProtKB/Swiss-Prot Length:88 Alignment length:58 40 50 60 70 80 MINE_ECOLI 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88 SCOP domains d1ev0b_ B: SCOP domains CATH domains 1ev0B00 B:31-88 Cell Cycle Chain A CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 1ev0 B 31 RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK 88 40 50 60 70 80
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 1EV0) |
NMR Structure(hide GO term definitions) Chain A,B (MINE_ECOLI | P0A734)
|
|
|
|
|
|
|