Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE XLP PROTEIN SAP IN COMPLEX WITH SLAM PHOSPHOPEPTIDE
 
Authors :  F. Poy, M. B. Yaffe, J. Sayos, K. Saxena, M. J. Eck
Date :  06 Oct 99  (Deposition) - 14 Oct 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Sh2 Domain, Phosphotyrosine Recogniiton, Peptide Recognition, Signal Transduction, Lymphoproliferative Disease, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Poy, M. B. Yaffe, J. Sayos, K. Saxena, M. Morra, J. Sumegi, L. C. Cantley, C. Terhorst, M. J. Eck
Crystal Structures Of The Xlp Protein Sap Reveal A Class Of Sh2 Domains With Extended, Phosphotyrosine-Independent Sequence Recognition.
Mol. Cell V. 4 555 1999
PubMed-ID: 10549287  |  Reference-DOI: 10.1016/S1097-2765(00)80206-3
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T CELL SIGNAL TRANSDUCTION MOLECULE SAP
    CellT CELL
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidT7-PRSET
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentSH2 DOMAIN
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSAP
    TissueBLOOD
 
Molecule 2 - SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE
    ChainsC, D
    EngineeredYES
    FragmentCYTOPLASMIC TAIL SYNTHETIC PHOSPOPEPTIDE
    Other DetailsTHIS PEPTIDE WAS CHEMICALLY SYNTHESIZED.
    SynonymSLAM
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PTR2Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1PTR1Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PTR1Mod. Amino AcidO-PHOSPHOTYROSINE

(-) Sites  (0, 0)

(no "Site" information available for 1D4W)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1D4W)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1D4W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (20, 40)

Asymmetric Unit (20, 40)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---A/BY7C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---A/BH8D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---A/BG16D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---A/BG27S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---A/BS28R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---A/BL31P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624A/BR32T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---A/BD33Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---A/BC42W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---A/BG49V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---A/BT53I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---A/BY54C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630A/BR55L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---A/BS57P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627A/BT68I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---A/BI84T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---A/BF87S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---A/BQ99P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184A/BP101L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---A/BV102G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (20, 20)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---AY7C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---AH8D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---AG16D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---AG27S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---AS28R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---AL31P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624AR32T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---AD33Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---AC42W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---AG49V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---AT53I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---AY54C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630AR55L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---AS57P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627AT68I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---AI84T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---AF87S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---AQ99P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184AP101L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---AV102G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (20, 20)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---BY7C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---BH8D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---BG16D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---BG27S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---BS28R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---BL31P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624BR32T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---BD33Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---BC42W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---BG49V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---BT53I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---BY54C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630BR55L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---BS57P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627BT68I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---BI84T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---BF87S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---BQ99P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184BP101L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---BV102G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
  2A:6-102
B:6-102
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
  1A:6-102
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
  1-
B:6-102

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003020351aENSE00001850818chr1:160617085-160616660426SLAF1_HUMAN1-26260--
1.2cENST000003020352cENSE00001166217chr1:160607319-160606981339SLAF1_HUMAN26-1391140--
1.3ENST000003020353ENSE00001166212chr1:160604687-160604403285SLAF1_HUMAN139-234960--
1.4ENST000003020354ENSE00001166202chr1:160593975-16059388690SLAF1_HUMAN234-264310--
1.5ENST000003020355ENSE00001166196chr1:160589639-16058956674SLAF1_HUMAN264-288252C:277-286
D:277-286
10
10
1.7ENST000003020357ENSE00001166189chr1:160582370-16058227893SLAF1_HUMAN289-319310--
1.8bENST000003020358bENSE00001820545chr1:160580588-1605778902699SLAF1_HUMAN320-335160--

2.1aENST000003711391aENSE00001920695X:123480194-123480629436SH21A_HUMAN1-46462A:1-46
B:3-46
46
44
2.3aENST000003711393aENSE00001327828X:123499611-12349967464SH21A_HUMAN46-67222A:46-67
B:46-67
22
22
2.4bENST000003711394bENSE00001306519X:123504026-123504170145SH21A_HUMAN68-116492A:68-104
B:68-104
37
37
2.5cENST000003711395cENSE00001917567X:123505201-1235070051805SH21A_HUMAN116-128130--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:104
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:104
                                    10        20        30        40        50        60        70        80        90       100    
          SH21A_HUMAN     1 MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 104
               SCOP domains d1d4wa_ A: The Xlp protein Sap                                                                           SCOP domains
               CATH domains 1d4wA00 A:1-104 SHC Adaptor Protein                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhh......................................................hhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ------CD-------D----------SR--PTY--------W------V---ICL-P----------I---------------T--S-----------P-LG-- SAPs(SNPs)
                    PROSITE -----SH2  PDB: A:6-102 UniProt: 6-102                                                                 -- PROSITE
           Transcript 2 (1) Exon 2.1a  PDB: A:1-46 UniProt: 1-46          ---------------------Exon 2.4b  PDB: A:68-104 [INCOMPLETE] Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------Exon 2.3a  PDB: A:46-6------------------------------------- Transcript 2 (2)
                 1d4w A   1 MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 104
                                    10        20        30        40        50        60        70        80        90       100    

Chain B from PDB  Type:PROTEIN  Length:102
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:102
                                    12        22        32        42        52        62        72        82        92       102  
          SH21A_HUMAN     3 AVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 104
               SCOP domains d1d4wb_ B: The Xlp protein Sap                                                                         SCOP domains
               CATH domains 1d4wB00 B:3-104 SHC Adaptor Protein                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeeeee.....eee............hhhhhhhhhh...........ee... Sec.struct. author
                 SAPs(SNPs) ----CD-------D----------SR--PTY--------W------V---ICL-P----------I---------------T--S-----------P-LG-- SAPs(SNPs)
                    PROSITE ---SH2  PDB: B:6-102 UniProt: 6-102                                                                 -- PROSITE
           Transcript 2 (1) Exon 2.1a  PDB: B:3-46 UniProt: 1-46        ---------------------Exon 2.4b  PDB: B:68-104 [INCOMPLETE] Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------Exon 2.3a  PDB: B:46-6------------------------------------- Transcript 2 (2)
                 1d4w B   3 AVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 104
                                    12        22        32        42        52        62        72        82        92       102  

Chain C from PDB  Type:PROTEIN  Length:10
 aligned with SLAF1_HUMAN | Q13291 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:10
                                   286
          SLAF1_HUMAN   277 SLTIYAQVQK 286
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
               Transcript 1 Exon 1.5   Transcript 1
                 1d4w C 277 SLTIyAQVQK 286
                                |  286
                              281-PTR 

Chain D from PDB  Type:PROTEIN  Length:10
 aligned with SLAF1_HUMAN | Q13291 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:10
                                   286
          SLAF1_HUMAN   277 SLTIYAQVQK 286
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author ..eee..... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
               Transcript 1 Exon 1.5   Transcript 1
                 1d4w D 277 SLTIyAQVQK 286
                                |  286
                              281-PTR 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1D4W)

(-) Gene Ontology  (48, 52)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SH21A_HUMAN | O60880)
molecular function
    GO:0005070    SH3/SH2 adaptor activity    Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0006968    cellular defense response    A defense response that is mediated by cells.
    GO:0006959    humoral immune response    An immune response mediated through a body fluid.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0045954    positive regulation of natural killer cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
    GO:0009967    positive regulation of signal transduction    Any process that activates or increases the frequency, rate or extent of signal transduction.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Chain C,D   (SLAF1_HUMAN | Q13291)
molecular function
    GO:0003823    antigen binding    Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0035744    T-helper 1 cell cytokine production    Any process that contributes to cytokine production by a T-helper 1 cell.
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0046649    lymphocyte activation    A change in morphology and behavior of a lymphocyte resulting from exposure to a specific antigen, mitogen, cytokine, chemokine, cellular ligand, or soluble factor.
    GO:0002277    myeloid dendritic cell activation involved in immune response    The change in morphology and behavior of a myeloid dendritic cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
    GO:0001779    natural killer cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a natural killer cell.
    GO:0001787    natural killer cell proliferation    The expansion of a natural killer cell population by cell division.
    GO:2000349    negative regulation of CD40 signaling pathway    Any process that stops, prevents or reduces the frequency, rate or extent of signaling via the CD40 signaling pathway.
    GO:0002725    negative regulation of T cell cytokine production    Any process that stops, prevents, or reduces the frequency, rate, or extent of T cell cytokine production.
    GO:1902714    negative regulation of interferon-gamma secretion    Any process that stops, prevents or reduces the frequency, rate or extent of interferon-gamma secretion.
    GO:0032695    negative regulation of interleukin-12 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-12 production.
    GO:0032715    negative regulation of interleukin-6 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
    GO:0032720    negative regulation of tumor necrosis factor production    Any process that stops, prevents, or reduces the frequency, rate, or extent of tumor necrosis factor production.
    GO:0006909    phagocytosis    An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0046330    positive regulation of JNK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the JNK cascade.
    GO:0042104    positive regulation of activated T cell proliferation    Any process that activates or increases the rate or extent of activated T cell proliferation.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:1902715    positive regulation of interferon-gamma secretion    Any process that activates or increases the frequency, rate or extent of interferon-gamma secretion.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0031338    regulation of vesicle fusion    Any process that modulates the frequency, rate or extent of vesicle fusion.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045335    phagocytic vesicle    A membrane-bounded intracellular vesicle that arises from the ingestion of particulate material by phagocytosis.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PTR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1d4w)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1d4w)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1d4w
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SH21A_HUMAN | O60880
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SLAF1_HUMAN | Q13291
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  308240
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SH21A_HUMAN | O60880
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SLAF1_HUMAN | Q13291
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SH21A_HUMAN | O608801d1z 1d4t 1ka6 1ka7 1m27
        SLAF1_HUMAN | Q132911d4t 1i3z 1ka6 1ka7 1m27 2dzf 2ie9 2ifl 2ig5

(-) Related Entries Specified in the PDB File

1d1z STRUCTURE OF THE UNLIGANDED DOMAIN
1d4t STRUCTURE OF THE SAP SH2 DOMAIN IN COMPLEX WITH NON- PHOSPHORYLATED PEPTIDE