Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE XLP PROTEIN SAP
 
Authors :  F. Poy, M. B. Yaffe, J. Sayos, K. Saxena, M. J. Eck
Date :  22 Sep 99  (Deposition) - 13 Oct 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  A (1x),B (1x),C (1x),D (1x)
Keywords :  Sh2 Domains, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Poy, M. B. Yaffe, J. Sayos, K. Saxena, M. Morra, J. Sumegi, L. C. Cantley, C. Terhorst, M. J. Eck
Crystal Structures Of The Xlp Protein Sap Reveal A Class Of Sh2 Domains With Extended, Phosphotyrosine-Independent Sequence Recognition.
Mol. Cell V. 4 555 1999
PubMed-ID: 10549287  |  Reference-DOI: 10.1016/S1097-2765(00)80206-3
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SAP SH2 DOMAIN
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorT7 EXPRESSION VECTOR
    FragmentSAP SH2 DOMAIN (RESIDUES 1-104)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)ABCD
Biological Unit 2 (1x)A (1x)B (1x)C (1x)D (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric Unit (1, 7)
No.NameCountTypeFull Name
1SO47Ligand/IonSULFATE ION
Biological Unit 1 (1, 7)
No.NameCountTypeFull Name
1SO47Ligand/IonSULFATE ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1SO4-1Ligand/IonSULFATE ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:1032 , SER A:1034 , GLU A:1035 , SER A:1036 , HOH A:6114 , HOH A:6125 , HOH A:6300BINDING SITE FOR RESIDUE SO4 A 5001
2AC2SOFTWAREARG B:2032 , SER B:2034 , GLU B:2035 , SER B:2036 , CYS B:2042 , ARG B:2055 , HOH B:6374 , ARG D:4013BINDING SITE FOR RESIDUE SO4 B 5002
3AC3SOFTWAREARG C:3032 , SER C:3034 , GLU C:3035 , SER C:3036 , CYS C:3042 , ARG C:3055 , HOH C:6138 , HOH C:6194 , HOH C:6280BINDING SITE FOR RESIDUE SO4 C 5003
4AC4SOFTWAREARG D:4013 , ARG D:4032 , SER D:4034 , GLU D:4035 , SER D:4036 , CYS D:4042 , ARG D:4055 , HOH D:6176BINDING SITE FOR RESIDUE SO4 D 5004
5AC5SOFTWAREPHE A:1077 , ARG A:1078 , LYS A:1079 , ASN A:1082 , HOH A:6266 , THR D:4061 , SER D:4063 , HOH D:6018 , HOH D:6475BINDING SITE FOR RESIDUE SO4 D 5005
6AC6SOFTWAREHIS A:1073 , ARG A:1075 , HOH A:6196 , THR D:4059 , GLU D:4060 , HOH D:6006 , HOH D:6462 , HOH D:6611BINDING SITE FOR RESIDUE SO4 D 5006
7AC7SOFTWAREPHE B:2077 , ARG B:2078 , LYS B:2079 , ASN B:2082 , HOH B:6627BINDING SITE FOR RESIDUE SO4 B 5007

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1D1Z)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1D1Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (20, 80)

Asymmetric Unit (20, 80)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---A
B
C
D
Y1007
2007
3007
4007
C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---A
B
C
D
H1008
2008
3008
4008
D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---A
B
C
D
G1016
2016
3016
4016
D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---A
B
C
D
G1027
2027
3027
4027
S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---A
B
C
D
S1028
2028
3028
4028
R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---A
B
C
D
L1031
2031
3031
4031
P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624A
B
C
D
R1032
2032
3032
4032
T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---A
B
C
D
D1033
2033
3033
4033
Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---A
B
C
D
C1042
2042
3042
4042
W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---A
B
C
D
G1049
2049
3049
4049
V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---A
B
C
D
T1053
2053
3053
4053
I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---A
B
C
D
Y1054
2054
3054
4054
C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630A
B
C
D
R1055
2055
3055
4055
L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---A
B
C
D
S1057
2057
3057
4057
P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627A
B
C
D
T1068
2068
3068
4068
I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---A
B
C
D
I1084
2084
3084
4084
T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---A
B
C
D
F1087
2087
3087
4087
S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---A
B
C
D
Q1099
2099
3099
4099
P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184A
B
C
D
P1101
2101
3101
4101
L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---A
B
C
D
V1102
2102
3102
4102
G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (20, 80)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Y1007
2007
3007
4007
C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
H1008
2008
3008
4008
D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1016
2016
3016
4016
D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1027
2027
3027
4027
S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
S1028
2028
3028
4028
R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
L1031
2031
3031
4031
P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624A
B
C
A/B/C/D
R1032
2032
3032
4032
T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
D1033
2033
3033
4033
Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
C1042
2042
3042
4042
W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1049
2049
3049
4049
V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
T1053
2053
3053
4053
I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Y1054
2054
3054
4054
C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630A
B
C
A/B/C/D
R1055
2055
3055
4055
L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---A
B
C
A/B/C/D
S1057
2057
3057
4057
P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627A
B
C
A/B/C/D
T1068
2068
3068
4068
I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
I1084
2084
3084
4084
T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
F1087
2087
3087
4087
S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Q1099
2099
3099
4099
P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184A
B
C
A/B/C/D
P1101
2101
3101
4101
L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
V1102
2102
3102
4102
G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (20, 80)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_048005Y7CSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Y1007
2007
3007
4007
C
02UniProtVAR_048006H8DSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
H1008
2008
3008
4008
D
03UniProtVAR_048007G16DSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1016
2016
3016
4016
D
04UniProtVAR_048008G27SSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1027
2027
3027
4027
S
05UniProtVAR_048009S28RSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
S1028
2028
3028
4028
R
06UniProtVAR_048010L31PSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
L1031
2031
3031
4031
P
07UniProtVAR_005612R32TSH21A_HUMANDisease (XLP1)111033624A
B
C
A/B/C/D
R1032
2032
3032
4032
T
08UniProtVAR_048011D33YSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
D1033
2033
3033
4033
Y
09UniProtVAR_048012C42WSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
C1042
2042
3042
4042
W
10UniProtVAR_048013G49VSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
G1049
2049
3049
4049
V
11UniProtVAR_048014T53ISH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
T1053
2053
3053
4053
I
12UniProtVAR_048015Y54CSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Y1054
2054
3054
4054
C
13UniProtVAR_018307R55LSH21A_HUMANDisease (XLP1)111033630A
B
C
A/B/C/D
R1055
2055
3055
4055
L
14UniProtVAR_048016S57PSH21A_HUMANUnclassified  ---A
B
C
A/B/C/D
S1057
2057
3057
4057
P
15UniProtVAR_005613T68ISH21A_HUMANDisease (XLP1)111033627A
B
C
A/B/C/D
T1068
2068
3068
4068
I
16UniProtVAR_048017I84TSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
I1084
2084
3084
4084
T
17UniProtVAR_048018F87SSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
F1087
2087
3087
4087
S
18UniProtVAR_048019Q99PSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
Q1099
2099
3099
4099
P
19UniProtVAR_005614P101LSH21A_HUMANDisease (XLP1)28935184A
B
C
A/B/C/D
P1101
2101
3101
4101
L
20UniProtVAR_048020V102GSH21A_HUMANDisease (XLP1)  ---A
B
C
A/B/C/D
V1102
2102
3102
4102
G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
 
 
  4A:1006-1102
B:2006-2102
C:3006-3102
D:4006-4102
Biological Unit 1 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
 
 
  4A:1006-1102
B:2006-2102
C:3006-3102
D:4006-4102
Biological Unit 2 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.SH21A_HUMAN6-102
 
 
 
  4A:1006-1102
B:2006-2102
C:3006-3102
D:4006-4102

(-) Exons   (3, 12)

Asymmetric Unit (3, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003711391aENSE00001920695X:123480194-123480629436SH21A_HUMAN1-46464A:1004-1046
B:2004-2046
C:3004-3046
D:4004-4046
43
43
43
43
1.3aENST000003711393aENSE00001327828X:123499611-12349967464SH21A_HUMAN46-67224A:1046-1067
B:2046-2067 (gaps)
C:3046-3067
D:4046-4067
22
22
22
22
1.4bENST000003711394bENSE00001306519X:123504026-123504170145SH21A_HUMAN68-116494A:1068-1104
B:2068-2104
C:3068-3104
D:4068-4104
37
37
37
37
1.5cENST000003711395cENSE00001917567X:123505201-1235070051805SH21A_HUMAN116-128130--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:101
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:101
                                    13        23        33        43        53        63        73        83        93       103 
         SH21A_HUMAN      4 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK  104
               SCOP domains d1d1za_ A: The Xlp protein Sap                                                                        SCOP domains
               CATH domains 1d1zA00 A:1004-1104 SHC Adaptor Protein                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeeeee.....eee............hhhhhhhhh............ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SH2  PDB: A:1006-1102 UniProt: 6-102                                                             -- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:1004-1046 UniProt: 1-46  ---------------------Exon 1.4b  PDB: A:1068-1104           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a             ------------------------------------- Transcript 1 (2)
                1d1z A 1004 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 1104
                                  1013      1023      1033      1043      1053      1063      1073      1083      1093      1103 

Chain B from PDB  Type:PROTEIN  Length:94
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:101
                                    13        23        33        43        53        63        73        83        93       103 
         SH21A_HUMAN      4 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK  104
               SCOP domains d1d1zb_ B: The Xlp protein Sap                                                                        SCOP domains
               CATH domains 1d1zB00 B:2004-2104 SHC Adaptor Protein                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeee.-------..............hhhhhhhhh............ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SH2  PDB: B:2006-2102 UniProt: 6-102                                                             -- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:2004-2046 UniProt: 1-46  ---------------------Exon 1.4b  PDB: B:2068-2104           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a             ------------------------------------- Transcript 1 (2)
                1d1z B 2004 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVS-------SAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 2104
                                  2013      2023      2033      2043      2053   |     - |    2073      2083      2093      2103 
                                                                              2057    2065                                       

Chain C from PDB  Type:PROTEIN  Length:101
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:101
                                    13        23        33        43        53        63        73        83        93       103 
         SH21A_HUMAN      4 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK  104
               SCOP domains d1d1zc_ C: The Xlp protein Sap                                                                        SCOP domains
               CATH domains 1d1zC00 C:3004-3104 SHC Adaptor Protein                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeeeee.....eee............hhhhhhhhh............ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SH2  PDB: C:3006-3102 UniProt: 6-102                                                             -- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:3004-3046 UniProt: 1-46  ---------------------Exon 1.4b  PDB: C:3068-3104           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a             ------------------------------------- Transcript 1 (2)
                1d1z C 3004 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 3104
                                  3013      3023      3033      3043      3053      3063      3073      3083      3093      3103 

Chain D from PDB  Type:PROTEIN  Length:101
 aligned with SH21A_HUMAN | O60880 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:101
                                    13        23        33        43        53        63        73        83        93       103 
         SH21A_HUMAN      4 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK  104
               SCOP domains d1d1zd_ D: The Xlp protein Sap                                                                        SCOP domains
               CATH domains 1d1zD00 D:4004-4104 SHC Adaptor Protein                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeeeee.....eee............hhhhhhhhh............ee... Sec.struct. author
                 SAPs(SNPs) ---CD-------D----------SR--PTY--------W------V---ICL-P----------I---------------T--S-----------P-LG-- SAPs(SNPs)
                    PROSITE --SH2  PDB: D:4006-4102 UniProt: 6-102                                                             -- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:4004-4046 UniProt: 1-46  ---------------------Exon 1.4b  PDB: D:4068-4104           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a             ------------------------------------- Transcript 1 (2)
                1d1z D 4004 VAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK 4104
                                  4013      4023      4033      4043      4053      4063      4073      4083      4093      4103 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1D1Z)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (SH21A_HUMAN | O60880)
molecular function
    GO:0005070    SH3/SH2 adaptor activity    Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0006968    cellular defense response    A defense response that is mediated by cells.
    GO:0006959    humoral immune response    An immune response mediated through a body fluid.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0045954    positive regulation of natural killer cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
    GO:0009967    positive regulation of signal transduction    Any process that activates or increases the frequency, rate or extent of signal transduction.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1d1z)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1d1z
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SH21A_HUMAN | O60880
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  308240
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SH21A_HUMAN | O60880
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SH21A_HUMAN | O608801d4t 1d4w 1ka6 1ka7 1m27

(-) Related Entries Specified in the PDB File

1d4t 1d4w