Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF THE COMPLEXES BETWEEN BOVINE CHYMOTRYPSINOGEN*A AND TWO RECOMBINANT VARIANTS OF HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL-TYPE)
 
Authors :  H. J. Hecht, M. Szardenings, J. Collins, D. Schomburg
Date :  08 Oct 91  (Deposition) - 31 Oct 93  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  E,I
Keywords :  Serine Protease/Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. J. Hecht, M. Szardenings, J. Collins, D. Schomburg
Three-Dimensional Structure Of The Complexes Between Bovine Chymotrypsinogen A And Two Recombinant Variants Of Human Pancreatic Secretory Trypsin Inhibitor (Kazal-Type).
J. Mol. Biol. V. 220 711 1991
PubMed-ID: 1870127  |  Reference-DOI: 10.1016/0022-2836(91)90112-J
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ALPHA-CHYMOTRYPSINOGEN
    ChainsE
    EngineeredYES
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 2 - PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE) VARIANT 3
    ChainsI
    EngineeredYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit EI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CGI)

(-) Sites  (0, 0)

(no "Site" information available for 1CGI)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1E:1 -E:122
2E:42 -E:58
3E:136 -E:201
4E:168 -E:182
5E:191 -E:220
6I:9 -I:38
7I:16 -I:35
8I:24 -I:56

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CGI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric/Biological Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_011689N34SISK1_HUMANDisease (TCP)17107315IN11S
2UniProtVAR_011690P55SISK1_HUMANPolymorphism111966833IP32S
3UniProtVAR_032012R67HISK1_HUMANPolymorphism35523678IR44H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (5, 5)

Asymmetric/Biological Unit (5, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.CTRA_BOVIN16-243  1E:16-243
2KAZAL_2PS51465 Kazal domain profile.ISK1_HUMAN26-79  1I:3-56
3KAZAL_1PS00282 Kazal serine protease inhibitors family signature.ISK1_HUMAN39-61  1I:16-38
4TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.CTRA_BOVIN53-58  1E:53-58
5TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.CTRA_BOVIN189-200  1E:189-200

(-) Exons   (3, 3)

Asymmetric/Biological Unit (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002966951aENSE00001082883chr5:147211349-147211086264ISK1_HUMAN1-19190--
1.2ENST000002966952ENSE00001082880chr5:147209193-14720916232ISK1_HUMAN19-29111I:1-66
1.3bENST000002966953bENSE00001082882chr5:147207691-147207585107ISK1_HUMAN30-65361I:7-4236
1.4bENST000002966954bENSE00002081650chr5:147204269-147204131139ISK1_HUMAN65-79151I:42-5615

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain E from PDB  Type:PROTEIN  Length:245
 aligned with CTRA_BOVIN | P00766 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240     
           CTRA_BOVIN     1 CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN 245
               SCOP domains d1cgie_ E: (alpha,gamma)-chymotrypsin(ogen)                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------1cgiE01     1cgiE02 E:28-120,E:233-245 Trypsin-like serine proteases                                     1cgiE01 E:16-27,E:121-232 Trypsin-like serine proteases                                                         1cgiE02       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................eeeeee...eeeeeeeee..eeeeee........eeeee...........eeeeeeeeeeee...........eeeeeee........................eeeeeeee.............eeeeeeeeeehhhhhhhhhhh....eeeeee...........eeeeeee..eeeeeeeeee........eeeeeeehhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------TRYPSIN_DOM  PDB: E:16-243 UniProt: 16-243                                                                                                                                                                                          -- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------------------------TRYPSI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cgi E   1 CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN 245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240     

Chain I from PDB  Type:PROTEIN  Length:56
 aligned with ISK1_HUMAN | P00995 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:56
                                    33        43        53        63        73      
           ISK1_HUMAN    24 DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC  79
               SCOP domains d1cgii_ I: Secretory trypsin inhibitor                   SCOP domains
               CATH domains 1cgiI00 I:1-56  [code=3.30.60.30, no name defined]       CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ......................eee...eee.hhhhhhhhhhhhh....eeee... Sec.struct. author
                 SAPs(SNPs) ----------S--------------------S-----------H------------ SAPs(SNPs)
                PROSITE (2) --KAZAL_2  PDB: I:3-56 UniProt: 26-79                    PROSITE (2)
                PROSITE (3) ---------------KAZAL_1  PDB: I:16-38  ------------------ PROSITE (3)
           Transcript 1 (1) 1.2   Exon 1.3b  PDB: I:7-42              -------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.4b       Transcript 1 (2)
                 1cgi I   1 DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC  56
                                    10        20        30        40        50      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CGI)

(-) Gene Ontology  (21, 24)

Asymmetric/Biological Unit(hide GO term definitions)
Chain E   (CTRA_BOVIN | P00766)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain I   (ISK1_HUMAN | P00995)
molecular function
    GO:0004866    endopeptidase inhibitor activity    Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0090281    negative regulation of calcium ion import    Any process that decreases the rate, frequency, or extent of the directed movement of calcium ions into a cell or organelle.
    GO:0010751    negative regulation of nitric oxide mediated signal transduction    Any process that decreases the rate, frequency or extent of nitric oxide mediated signal transduction. Nitric oxide mediated signal transduction is a series of molecular signals mediated by the detection of nitric oxide (NO).
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
    GO:0050732    negative regulation of peptidyl-tyrosine phosphorylation    Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:1900004    negative regulation of serine-type endopeptidase activity    Any process that stops, prevents or reduces the frequency, rate or extent of serine-type endopeptidase activity.
    GO:0060046    regulation of acrosome reaction    Any process that modulates the frequency, rate or extent of the acrosome reaction.
    GO:2001256    regulation of store-operated calcium entry    Any process that modulates the frequency, rate or extent of store-operated calcium entry.
cellular component
    GO:0001669    acrosomal vesicle    A structure in the head of a spermatozoon that contains acid hydrolases, and is concerned with the breakdown of the outer membrane of the ovum during fertilization. It lies just beneath the plasma membrane and is derived from the lysosome.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cgi)
 
  Sites
(no "Sites" information available for 1cgi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cgi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cgi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CTRA_BOVIN | P00766
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ISK1_HUMAN | P00995
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  608189
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CTRA_BOVIN | P00766
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ISK1_HUMAN | P00995
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CTRA_BOVIN | P007661ab9 1acb 1afq 1ca0 1cbw 1cgj 1chg 1cho 1dlk 1ex3 1gcd 1gct 1gg6 1ggd 1gha 1ghb 1gl0 1gl1 1gmc 1gmd 1gmh 1hja 1k2i 1mtn 1n8o 1oxg 1p2m 1p2n 1p2o 1p2q 1t7c 1t8l 1t8m 1t8n 1t8o 1vgc 1yph 2cga 2cha 2gch 2gct 2gmt 2p8o 2vgc 2y6t 3bg4 3gch 3gct 3ru4 3t62 3vgc 4cha 4gch 4q2k 4vgc 5cha 5gch 5j4q 5j4s 6cha 6gch 7gch 8gch
        ISK1_HUMAN | P009951cgj 1hpt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CGI)