Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PROTEASOME ACTIVATOR REG(ALPHA)
 
Authors :  C. P. Hill, J. R. Knowlton
Date :  18 Sep 97  (Deposition) - 31 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N
Keywords :  Proteasome Activator, Cell Adhesion, Interferon Induction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. R. Knowlton, S. C. Johnston, F. G. Whitby, C. Realini, Z. Zhang, M. Rechsteiner, C. P. Hill
Structure Of The Proteasome Activator Regalpha (Pa28Alpha).
Nature V. 390 639 1997
PubMed-ID: 9403698  |  Reference-DOI: 10.1038/37670
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 11S REGULATOR
    Cell LineBL21
    ChainsA, C, E, G, I, K, M
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPAED4
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymREG(ALPHA), PA28(ALPHA)
 
Molecule 2 - 11S REGULATOR
    Cell LineBL21
    ChainsB, D, F, H, J, L, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPAED4
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymREG(ALPHA), PA28(ALPHA)

 Structural Features

(-) Chains, Units

  1234567891011121314
Asymmetric/Biological Unit ABCDEFGHIJKLMN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AVO)

(-) Sites  (0, 0)

(no "Site" information available for 1AVO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AVO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1AVO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 7)

Asymmetric/Biological Unit (1, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_011993S55NPSME1_HUMANPolymorphism1803830A/C/E/G/I/K/MS55N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AVO)

(-) Exons   (10, 70)

Asymmetric/Biological Unit (10, 70)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002064511aENSE00001921380chr14:24605367-24605510144PSME1_HUMAN1-13137A:4-13
-
C:4-13
-
E:4-13
-
G:4-13
-
I:4-13
-
K:4-13
-
M:4-13
-
10
-
10
-
10
-
10
-
10
-
10
-
10
-
1.2bENST000002064512bENSE00000654218chr14:24606194-2460622633PSME1_HUMAN14-24117A:14-24
-
C:14-24
-
E:14-24
-
G:14-24
-
I:14-24
-
K:14-24
-
M:14-24
-
11
-
11
-
11
-
11
-
11
-
11
-
11
-
1.3ENST000002064513ENSE00000654219chr14:24606352-2460641463PSME1_HUMAN25-45217A:25-45
-
C:25-45
-
E:25-45
-
G:25-45
-
I:25-45
-
K:25-45
-
M:25-45
-
21
-
21
-
21
-
21
-
21
-
21
-
21
-
1.4aENST000002064514aENSE00001331545chr14:24606530-24606640111PSME1_HUMAN46-82377A:46-63
-
C:46-63
-
E:46-63
-
G:46-63
-
I:46-63
-
K:46-63
-
M:46-63
-
18
-
18
-
18
-
18
-
18
-
18
-
18
-
1.5ENST000002064515ENSE00000889355chr14:24606729-2460677446PSME1_HUMAN83-98160--
1.6bENST000002064516bENSE00000654229chr14:24606909-2460700698PSME1_HUMAN98-130337-
B:103-130
-
D:103-130
-
F:103-130
-
H:103-130
-
J:103-130
-
L:103-130
-
N:103-130
-
28
-
28
-
28
-
28
-
28
-
28
-
28
1.7ENST000002064517ENSE00001331537chr14:24607258-2460732669PSME1_HUMAN131-153237-
B:131-153
-
D:131-153
-
F:131-153
-
H:131-153
-
J:131-153
-
L:131-153
-
N:131-153
-
23
-
23
-
23
-
23
-
23
-
23
-
23
1.8ENST000002064518ENSE00000930104chr14:24607405-2460747268PSME1_HUMAN154-176237-
B:154-176
-
D:154-176
-
F:154-176
-
H:154-176
-
J:154-176
-
L:154-176
-
N:154-176
-
23
-
23
-
23
-
23
-
23
-
23
-
23
1.9ENST000002064519ENSE00000930105chr14:24607554-2460760855PSME1_HUMAN176-194197-
B:176-194
-
D:176-194
-
F:176-194
-
H:176-194
-
J:176-194
-
L:176-194
-
N:176-194
-
19
-
19
-
19
-
19
-
19
-
19
-
19
1.10aENST0000020645110aENSE00000654234chr14:24607683-2460776987PSME1_HUMAN195-223297-
B:195-223
-
D:195-223
-
F:195-223
-
H:195-223
-
J:195-223
-
L:195-223
-
N:195-223
-
29
-
29
-
29
-
29
-
29
-
29
-
29
1.10dENST0000020645110dENSE00001421259chr14:24607945-24608176232PSME1_HUMAN224-249267-
B:224-242
-
D:224-242
-
F:224-242
-
H:224-242
-
J:224-242
-
L:224-242
-
N:224-242
-
19
-
19
-
19
-
19
-
19
-
19
-
19

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.1 A:,B: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoA00 A:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: A:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo A   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain B from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.1 A:,B: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoB00 B:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: B:131-15Exon 1.8  PDB: B:154-17------------------Exon 1.10a  PDB: B:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: B:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo B 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain C from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.2 C:,D: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoC00 C:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: C:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo C   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain D from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.2 C:,D: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoD00 D:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: D:131-15Exon 1.8  PDB: D:154-17------------------Exon 1.10a  PDB: D:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: D:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo D 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain E from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.3 E:,F: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoE00 E:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: E:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo E   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain F from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.3 E:,F: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoF00 F:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: F:131-15Exon 1.8  PDB: F:154-17------------------Exon 1.10a  PDB: F:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: F:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo F 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain G from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.4 G:,H: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoG00 G:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: G:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo G   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain H from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.4 G:,H: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoH00 H:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: H:131-15Exon 1.8  PDB: H:154-17------------------Exon 1.10a  PDB: H:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: H:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo H 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain I from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.5 I:,J: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoI00 I:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: I:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo I   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain J from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.5 I:,J: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoJ00 J:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: J:131-15Exon 1.8  PDB: J:154-17------------------Exon 1.10a  PDB: J:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: J:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo J 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain K from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.6 K:,L: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoK00 K:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: K:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo K   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain L from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.6 K:,L: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoL00 L:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: L:131-15Exon 1.8  PDB: L:154-17------------------Exon 1.10a  PDB: L:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: L:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo L 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

Chain M from PDB  Type:PROTEIN  Length:60
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:60
                                    13        23        33        43        53        63
          PSME1_HUMAN     4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
               SCOP domains d1avo.7 M:,N: Proteasome activator reg(alpha)                SCOP domains
               CATH domains 1avoM00 M:4-63  [code=1.20.5.120, no name defined]           CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------N-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a Exon 1.2b  Exon 1.3  PDB: M:25-4Exon 1.4a          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------ Transcript 1 (2)
                 1avo M   4 LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI  63
                                    13        23        33        43        53        63

Chain N from PDB  Type:PROTEIN  Length:140
 aligned with PSME1_HUMAN | Q06323 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:140
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242
          PSME1_HUMAN   103 PVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
               SCOP domains d1avo.7 M:,N: Proteasome activator reg(alpha)                                                                                                SCOP domains
               CATH domains 1avoN00 N:103-242  [code=1.20.120.180, no name defined]                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.7  PDB: N:131-15Exon 1.8  PDB: N:154-17------------------Exon 1.10a  PDB: N:195-223   Exon 1.10d          Transcript 1 (1)
           Transcript 1 (2) Exon 1.6b  PDB: N:103-130   ---------------------------------------------Exon 1.9           ------------------------------------------------ Transcript 1 (2)
                 1avo N 103 AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG 242
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 7)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 14)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AVO)

(-) Gene Ontology  (28, 28)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N   (PSME1_HUMAN | Q06323)
molecular function
    GO:0061133    endopeptidase activator activity    Increases the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
biological process
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0060071    Wnt signaling pathway, planar cell polarity pathway    The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
    GO:0031145    anaphase-promoting complex-dependent catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
    GO:0019884    antigen processing and presentation of exogenous antigen    The process in which an antigen-presenting cell expresses antigen (peptide or lipid) of exogenous origin on its cell surface in association with an MHC protein complex.
    GO:0002479    antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0051436    negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin ligase activity that contributes to the mitotic cell cycle.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0010950    positive regulation of endopeptidase activity    Any process that increases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:2000045    regulation of G1/S transition of mitotic cell cycle    Any cell cycle regulatory process that controls the commitment of a cell from G1 to S phase of the mitotic cell cycle.
    GO:0006521    regulation of cellular amino acid metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving amino acids.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0061136    regulation of proteasomal protein catabolic process    Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0008537    proteasome activator complex    A multisubunit complex that activates the hydrolysis of small nonubiquitinated peptides by binding to the proteasome core complex.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1avo)
 
  Sites
(no "Sites" information available for 1avo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1avo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1avo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PSME1_HUMAN | Q06323
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PSME1_HUMAN | Q06323
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AVO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AVO)